|
Example 4: mutation and modification
Based in part on
Davies, G. J., Ducros, V., Lewis, R. J., Borchert, T. V.
& Schulein, M. (1997).
Oligosaccharide specificity of a family 7 endoglucanase: insertion
of potential sugar-binding subsites.
J. Biotechnol. 57, 91
[1A39].
In the example below, the items in gray
are identifiers and qualifiers needed to preserve the mmCIF data
structure (and auto-generated during the deposition procedure), or
other data items stored in the same category in a PDB deposition, but
not normally published in the journal.
Wherever possible, one should distinguish within a CIF between items that
are unknown, denoted by a
query character (?), and those that are not applicable,
denoted by a full stop character (.).
The example below tries to preserve this distinction, but
PDB depositions may not always be able to provide this discrimination.
_entry.id 1A39
_struct.title 'Humicola insolens endocellulase EGI (S37W, P39W double-mutant)'
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.details
_entity.pdbx_mutation
_entity.pdbx_number_of_molecules
_entity.pdbx_fragment
_entity.pdbx_ec
1 polymer man 'endoglucanase I' 44821.914
; pyroglutamate post-translational modification at residue 1 N-linked
N-acetylglucosamine on residue ASN 247
;
'S37W, P39W' 1 ? 3.2.1.4
2 non-polymer man 'sugar (N-acetyl-D-glucosamine)' 221.210 ? ? 1 ? ?
3 water nat water 18.015 ? ? 327 ? ?
_struct_biol.details
; Enzyme is a monomer of 402 residues. Residues Ser 37 and Pro 39 have
been mutated to Trp residues for purposes of this study. Residue
Glu 1 is post-translationally modified to pyroglutamate. Enzyme is
glycosylated at residue Asn 247 by N-linkage of an N-acetylglucosamine.
;
_struct_biol.pdbx_formula_weight 44822
_struct_biol.pdbx_formula_weight_method
'calculated from sequence with mutations, modification and glycosylation'
_entity_poly.entity_id 1
_entity_poly.type polypeptide(L)
_entity_poly.pdbx_seq_one_letter_code
;(5HP)KPGETKEVHPQLTTFRCTKRGGCKPATNFIVLDSLWHWIHRAEGLGPGGCGDWGNPPPKDVCPDVESCAKNCIME
GIPDYSQYGVTTNGTSLRLQHILPDGRVPSPRVYLLDKTKRRYEMLHLTGFEFTFDVDATKLPCGMNSALYLSEMHPTGA
KSKYNPGGAYYGTGYCDAQCFVTPFINGLGNIEGKGSCCNEMDIWEANSRASHVAPHTCNKKGLYLCEGEECAFEGVCDK
NGCGWNNYRVNVTDYYGRGEEFKVNTLKPFTVVTQFLANRRGKLEKIHRFYVQDGKVIESFYTNKEGVPYTNMIDDEFCE
ATGSRKYMELGATQGMGEALTRGMVLAMSIWWDQGGNMEWLDHGEAGPCAKGEGAPSNIVQVEPFPEVTYTNLRWGEIGS
TYQELQ
;
_entity_poly.pdbx_seq_one_letter_code_can
;EKPGETKEVHPQLTTFRCTKRGGCKPATNFIVLDSLWHWIHRAEGLGPGGCGDWGNPPPKDVCPDVESCAKNCIMEGIPD
YSQYGVTTNGTSLRLQHILPDGRVPSPRVYLLDKTKRRYEMLHLTGFEFTFDVDATKLPCGMNSALYLSEMHPTGAKSKY
NPGGAYYGTGYCDAQCFVTPFINGLGNIEGKGSCCNEMDIWEANSRASHVAPHTCNKKGLYLCEGEECAFEGVCDKNGCG
WNNYRVNVTDYYGRGEEFKVNTLKPFTVVTQFLANRRGKLEKIHRFYVQDGKVIESFYTNKEGVPYTNMIDDEFCEATGS
RKYMELGATQGMGEALTRGMVLAMSIWWDQGGNMEWLDHGEAGPCAKGEGAPSNIVQVEPFPEVTYTNLRWGEIGSTYQE
LQ
;
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2 'sugar (N-acetyl-D-glucosamine)' NAG
3 water HOH
_struct_ref.id 1
_struct_ref.db_name SWS
_struct_ref.db_code GUN1_HUMIN
_struct_ref.entity_id 1
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_gene_src_scientific_name 'Humicola insolens'
_entity_src_gen.pdbx_gene_src_strain ?
_entity_src_gen.pdbx_gene_src_details ?
How this example will appear in the journal
| Macromolecule details |
| Component molecules
|
endoglucanase I,
sugar (N-acetyl-D-glucosamine),
water
|
| Macromolecular assembly
|
Enzyme is a monomer of 402 residues. Residues Ser 37 and Pro 39 have
been mutated to Trp residues for purposes of this study. Residue
Glu 1 is post-translationally modified to pyroglutamate. Enzyme is
glycosylated at residue Asn 247 by N-linkage of an N-acetylglucosamine.
|
| Mass (Da)
|
44822 (calculated from sequence with mutations,
modification and glycosylation)
|
| Source organism
|
Humicola insolens
|
|
|