research papers\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983

Crystal structures of adenylylated and unadenylylated PII protein GlnK from Corynebacterium glutamicum

CROSSMARK_Color_square_no_text.svg

aDivision of Biotechnology, Department of Biology, Friedrich-Alexander-Universität Erlangen-Nürnberg, Henkestrasse 91, 91052 Erlangen, Germany, and bDivision of Microbiology, Department of Biology, Friedrich-Alexander-Universität Erlangen-Nürnberg, Staudtstrasse 5, 91058 Erlangen, Germany
*Correspondence e-mail: [email protected]

Edited by K. Djinovic Carugo, University of Vienna, Austria (Received 12 October 2020; accepted 21 January 2021; online 19 February 2021)

PII proteins are ubiquitous signaling proteins that are involved in the regulation of the nitrogen/carbon balance in bacteria, archaea, and some plants and algae. Signal transduction via PII proteins is modulated by effector molecules and post-translational modifications in the PII T-loop. Whereas the binding of ADP, ATP and the concomitant binding of ATP and 2-oxoglutarate (2OG) engender two distinct conformations of the T-loop that either favor or disfavor the interaction with partner proteins, the structural consequences of post-translational modifications such as phosphorylation, uridylylation and adenylylation are far less well understood. In the present study, crystal structures of the PII protein GlnK from Corynebacterium glutamicum have been determined, namely of adenylylated GlnK (adGlnK) and unmodified unadenylylated GlnK (unGlnK). AdGlnK has been proposed to act as an inducer of the transcription repressor AmtR, and the adenylylation of Tyr51 in GlnK has been proposed to be a prerequisite for this function. The structures of unGlnK and adGlnK allow the first atomic insights into the structural implications of the covalent attachment of an AMP moiety to the T-loop. The overall GlnK fold remains unaltered upon adenylylation, and T-loop adenylylation does not appear to interfere with the formation of the two major functionally important T-loop conformations, namely the extended T-loop in the canonical ADP-bound state and the compacted T-loop that is adopted upon the simultaneous binding of Mg-ATP and 2OG. Thus, the PII-typical conformational switching mechanism appears to be preserved in GlnK from C. glutamicum, while at the same time the functional repertoire becomes expanded through the accommodation of a peculiar post-translational modification.

1. Introduction

The PII protein family consists of a group of ubiquitous signal transduction proteins that are not only present in proteobacteria, actinobacteria and cyanobacteria, but are also found in archaea and in the chloroplasts of certain algae and plants (Huergo et al., 2003[Huergo, L. F., Souza, E. M., Steffens, M. B., Yates, M. G., Pedrosa, F. O. & Chubatsu, L. S. (2003). FEMS Microbiol. Lett. 223, 33-40.]). PII proteins have not been observed in animals and fungi to date (Merrick, 2014[Merrick, M. (2014). Front. Microbiol. 5, 763.]). Whereas many organisms encode multiple PII paralogues, some organisms, such as most cyanobacteria, harbor only a single PII protein (Merrick, 2014[Merrick, M. (2014). Front. Microbiol. 5, 763.]).

The prototypical PII proteins GlnB and GlnK are among the best-studied PII proteins. They function as sensors of the nitrogen/carbon status and actively participate in the regulation of cellular nitrogen/carbon uptake. Sensing is achieved via the interaction of the PII protein with specific effectors such as ADP, Mg-ATP and 2-oxoglutarate (2OG). In addition, post-translational modifications such as uridylylation, adenylylation and phosphorylation may also occur (Merrick, 2014[Merrick, M. (2014). Front. Microbiol. 5, 763.]). The formation of PII–effector ligand complexes engenders distinct protein conformational states (Forcada-Nadal et al., 2018[Forcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.]; Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]; Fokina et al., 2010[Fokina, O., Chellamuthu, V. R., Forchhammer, K. & Zeth, K. (2010). Proc. Natl Acad. Sci. USA, 107, 19760-19765.]; Truan et al., 2010[Truan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531-539.]). The ADP-bound state is formed when cellular 2OG concentrations are low. This also signals high availability of nitrogen, since nitrogen abundance causes the conversion of 2OG to L-glutamate and hence the depletion of 2OG (Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]). Conversely, the complex with Mg-ATP and 2OG is formed when 2OG concentrations are high, in testimony of an abundance of carbon and a shortage of nitrogen. These distinct states act as a nitrogen/carbon balance controller through the formation of effector-specific protein–protein complexes and the concomitant regulation of the activity of transporters, enzymes and transcription factors (Forcada-Nadal et al., 2018[Forcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.]; Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]).

All PII proteins share a high level of structure and sequence similarity. They form homotrimers with C3 point-group symmetry (Forcada-Nadal et al., 2018[Forcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.]; Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]; Fig. 1[link]). Each monomer displays a central four-stranded β-sheet that is flanked on either side by additional β-strands contributed by the two additional subunits present in the trimeric assembly. Effector binding occurs at the interface between subunits and involves interactions with three loop regions, called the B-, C- and T-loops (Fig. 1[link]). The allosteric signal that links effector binding to the regulation of the activity of PII-interacting proteins is primarily transduced via the T-loop, which adopts different conformations depending on the nature and combination of bound effectors. The T-loop also harbors all presently known post-translational modification sites (Merrick, 2014[Merrick, M. (2014). Front. Microbiol. 5, 763.]). Among the most important functionally mapped T-loop conformations are the extended conformation that is stabilized upon ADP binding, the semi-variable conformation that is induced by Mg-ATP and the compacted conformation that is induced upon the binding of Mg-ATP and 2OG (Truan et al., 2014[Truan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783-2799.]). While the former two conformations enable the interaction of PII proteins with distinct target proteins, the latter conformation is generally considered to abrogate any binding interactions (Fokina et al., 2010[Fokina, O., Chellamuthu, V. R., Forchhammer, K. & Zeth, K. (2010). Proc. Natl Acad. Sci. USA, 107, 19760-19765.]; Truan et al., 2010[Truan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531-539.]; Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]). Additional variations in the T-loop conformation and the binding of additional effectors, such as the binding of AMP and ATP without Mg2+, may also occur and have been reported for some PII proteins (Forcada-Nadal et al., 2018[Forcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.]). Moreover, in many plants glutamine acts as an additional effector, albeit binding to a different binding site (Forcada-Nadal et al., 2018[Forcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.]).

[Figure 1]
Figure 1
Canonical structure of PII proteins. (a) Topology plot of a PII monomer. Structural features such as the B-, C- and T-loops, as well as the post-translational modification site located in the T-loop, are highlighted. (b) PII protein trimer displaying C3 point-group symmetry. Each protomer is depicted in a different color. (c) Hexameric assembly with D3 point-group symmetry of two PII trimers as observed in the crystal structures of unGlnK and adGlnK from C. glutamicum. The symmetry elements present in point groups C3 and D3 are illustrated as follows: black triangles indicate threefold rotation axes oriented perpendicular to the plane of the illustration and black arrows indicate twofold rotation axes located in the plane of the illustration.

In the present study, we determined crystal structures of the PII protein GlnK from Corynebacterium glutamicum in its post-translationally modified adenylylated (adGlnK) and unmodified unadenylylated (unGlnK) states. The crystal structure of a similarly modified PII protein, namely that of uridylylated GlnB from Escherichia coli, has previously been determined. However, the part of the T-loop carrying the post-translational modification was not resolved in this structure (Palanca & Rubio, 2017[Palanca, C. & Rubio, V. (2017). Environ. Microbiol. Rep. 9, 290-299.]). It has been proposed that adGlnK acts as an inducer of the global bacterial transcription regulator AmtR and thereby regulates nitrogen metabolism in C. glutamicum (Beckers et al., 2005[Beckers, G., Strösser, J., Hildebrandt, U., Kalinowski, J., Farwick, M., Krämer, R. & Burkovski, A. (2005). Mol. Microbiol. 58, 580-595.]; Strösser et al., 2004[Strösser, J., Lüdke, A., Schaffer, S., Krämer, R. & Burkovski, A. (2004). Mol. Microbiol. 54, 132-147.]). Deletion of the glnK gene abolishes the upregulation of AmtR-controlled genes, and the derepression of genes under AmtR only occurs if GlnK is adenylylated at position 51, since exchanging Tyr51 for phenylalanine resulted in an identical phenotype to those observed for glnK deletion mutants (Nolden et al., 2001[Nolden, L., Ngouoto-Nkili, C. E., Bendt, A. K., Krämer, R. & Burkovski, A. (2001). Mol. Microbiol. 42, 1281-1295.]; Beckers et al., 2005[Beckers, G., Strösser, J., Hildebrandt, U., Kalinowski, J., Farwick, M., Krämer, R. & Burkovski, A. (2005). Mol. Microbiol. 58, 580-595.]). Whereas the interaction between AmtR and its target DNA has been well characterized, the details and structural implications of the adenylylation of GlnK as well as the mechanism by which adGlnK derepresses AmtR-controlled gene transcription currently remain largely elusive (Palanca & Rubio, 2016[Palanca, C. & Rubio, V. (2016). FEBS J. 283, 1039-1059.]; Sevvana et al., 2017[Sevvana, M., Hasselt, K., Grau, F. C., Burkovski, A. & Muller, Y. A. (2017). Acta Cryst. F73, 146-151.]).

2. Methods

2.1. Expression and purification of unGlnK and adGlnK

UnGlnK from C. glutamicum (UniProt entry Q79VF2; The UniProt Consortium, 2017[The UniProt Consortium (2017). Nucleic Acids Res. 45, D158-D169.]) was expressed in Escherichia coli BL21(DE3) cells with an N-terminal His tag. The cells were grown in LB medium in the presence of 100 µg ml−1 ampicillin at 310 K to an OD600 of 0.5 (Table 1[link]). The temperature was subsequently decreased to 293 K and protein overexpression was induced with 1.0 mM isopropyl β-D-1-thiogalactopyranoside (IPTG). After 18 h, the cells were harvested via centrifugation and resuspended in lysis buffer (50 mM NaH2PO4 pH 8.0, 300 mM NaCl, 20 mM imidazole, 1 mM lysozyme, 1 mM phenylmethanesulfonyl fluoride) at a ratio of 10 ml buffer per gram of pellet prior to lysis via sonication. After centrifugation at 95 000g and 277 K for 1 h, the supernatant was filtered through a 0.45 µm filter (Millipore) and subsequently loaded onto a 5 ml HisTrap FF column (GE Healthcare). UnGlnK was eluted with a linear gradient of His elution buffer (50 mM NaH2PO4 pH 8.0, 300 mM NaCl, 500 mM imidazole) over 15 column volumes (CV). Fractions containing the target protein were pooled and the His tag was cleaved off overnight at 289 K with thrombin at a ratio of 5 NIH units per milligram of unGlnK. Proteolytic cleavage was stopped by the addition of 1 mM 4-(2-aminoethyl)benzenesulfonyl fluoride. The sample was further purified via size-exclusion chromatography using a Superdex 75 16/600 column (GE Healthcare) pre-equilibrated in gel-filtration buffer (20 mM Tris–HCl pH 8.0, 200 mM NaCl, 1 mM EDTA). Fractions containing pure target protein, as verified by SDS–PAGE (Laemmli, 1970[Laemmli, U. K. (1970). Nature, 227, 680-685.]), were pooled, concentrated and used immediately in crystallization trials.

Table 1
Macromolecule-production information

  UnGlnK AdGlnK
Source organism C. glutamicum C. glutamicum
DNA source C. glutamicum genomic DNA C. glutamicum genomic DNA
Forward primer GCCAATTGTACCATATGAGCTTGCATGCCTGC † CCATGCGGATTAAAGGGCTGCTTCGCCGC ‡
Reverse primer GGGCCGCTCGAGTCATCAAAGGGCTGCTTCGCC § GCGGCGAAGCAGCCCTTTAATCCGCATGG ‡
Cloning vector pZ8-1glnK-Xa-C-Strep pZ8-1glnK-Xa-C-Strep
Expression vector pET-15bglnK pZ8-1glnK
Expression host E. coli BL21(DE3) C. glutamicum ATCC 13032
Complete amino-acid sequence of the construct produced MGSSHHHHHHSSGLVPRGSHMSLHACRMKLITAIVKPFTLTDIKDALEQAGVQGMTVTETQGFGQQKGHTEVYRGAEYAVDFVPKVKIEVIISDAQAEEVINIIVETARTGKVGDGKVWMTNIEELVRVRTGERGEAAL MKLITAIVKPFTLTDIKDALEQAGVQGMTVTETQGFGQQKGHTEVYRGAEYAVDFVPKVKIEVIISDAQAEEVINIIVETARTGKVGDGKVWMTNIEELVRVRTGERGEAAL
†The restriction site for NdeI is underlined.
‡The inserted stop codon is underlined.
§The restriction site for XhoI is underlined.

AdGlnK was expressed in C. glutamicum ATCC 13032 cells transformed via electroporation with the constitutive expression vector pZ8-1glnK-Xa-C-Strep (Dusch et al., 1999[Dusch, N., Pühler, A. & Kalinowski, J. (1999). Appl. Environ. Microbiol. 65, 1530-1539.]; Table 1[link]). Freshly transformed cells were grown on BHI agar in the presence of 15 µg ml−1 kanamycin at 303 K for 48 h. A single colony was used to inoculate a starter culture in BHI medium in the presence of 25 µg ml−1 kanamycin at 303 K for 6 h. Identical kanamycin concentrations and temperatures were used in all subsequent culturing steps. The starter culture was used to inoculate an overnight culture in kanamycin-containing CgC medium (Keilhauer et al., 1993[Keilhauer, C., Eggeling, L. & Sahm, H. (1993). J. Bacteriol. 175, 5595-5603.]) in order to allow the adaptation of C. glutamicum to minimal medium. The main expression culture was inoculated at an OD600 of 1.0 in kanamycin-containing CgC medium and the cells were grown to an OD600 of 4.0–4.5. The cells were then washed twice via centrifugation followed by resuspension in CgCoN medium (Jakoby et al., 2000[Jakoby, M., Nolden, L., Meier-Wagner, J., Krämer, R. & Burkovski, A. (2000). Mol. Microbiol. 37, 964-977.]) in order to remove any nitrogen sources and induce the adenylylation of GlnK. The cells were incubated for an additional 1.5 h in kanamycin-containing CgCoN before being harvested via centrifugation (5000g) at 277 K. The cells were resuspended in IEX buffer (20 mM Tris–HCl pH 6.5, 50 mM NaCl) supplemented with 10 mg ml−1 lysozyme and one cOmplete protease-inhibitor tablet (Roche) per 30 ml buffer at a ratio of 5 ml buffer per gram of pellet. The cell suspension was split into 1 ml aliquots in sterile 2 ml reaction tubes containing 300 mg of 0.2 µm glass beads and subjected to three consecutive 25 s cycles of high-frequency shaking at 6.5 m s−1 using a Precellys 24 tissue homogenizer (Bertin Technologies). The sample was chilled on ice for 2 min between cycles. The lysate was cleared by centrifugation at 95 000g and subsequent filtration through a 0.45 µm filter (Millipore). The cleared lysate was loaded onto a 1 ml SP Sepharose FF column (GE Healthcare) in order to remove lysozyme. The flowthrough fractions containing adGlnk were applied onto a 1 ml Q Sepharose FF column (GE Healthcare) and adGlnK was eluted via a gradient step of 33% IEX elution buffer (20 mM Tris–HCl pH 6.5, 1 M NaCl). Fractions containing the target protein were pooled, transferred into Mono Q buffer (20 mM Tris–HCl pH 7.0, 50 mM NaCl) using a desalting column and loaded onto a Mono Q 5/50 GL column (GE Healthcare). AdGlnK was eluted with a linear gradient of Mono Q elution buffer (20 mM Tris–HCl pH 7.0, 500 mM NaCl) over 30 CV and subjected to a final purification step using a Superdex 75 16/600 size-exclusion chromatography column pre-equilibrated with 20 mM Tris–HCl pH 7.5, 50 mM NaCl, 2 mM MgCl2. Fractions containing pure target protein, as verified by SDS–PAGE (Laemmli, 1970[Laemmli, U. K. (1970). Nature, 227, 680-685.]), were pooled, concentrated and used immediately in crystallization trials. Adenylylation was investigated and confirmed by mass spectrometry (Supplementary Fig. S1)

2.2. Crystallization

UnGlnK was crystallized using the sitting-drop vapor-diffusion method by mixing 0.2 µl unGlnK (13 mg ml−1 unGlnK in 20 mM Tris–HCl pH 8.0, 200 mM NaCl, 1 mM EDTA) with 0.2 µl reservoir solution and equilibrating against 70 µl reservoir solution at 292 K (Table 2[link]). Diffraction-quality crystals were obtained with a reservoir solution consisting of 2.0 M ammonium sulfate, 5%(v/v) 2-propanol.

Table 2
Crystallization

  UnGlnK AdGlnK
Method Sitting-drop vapor diffusion Hanging-drop vapor diffusion
Plate type Greiner CrystalQuick 96-well ComboPlate 24-well
Temperature (K) 292 292
Protein concentration (mg ml−1) 13 11
Buffer composition of protein solution 20 mM Tris–HCl pH 8.0, 200 mM NaCl, 1 mM EDTA 20 mM Tris–HCl pH 7.5, 50 mM NaCl, 2 mM MgCl2
Composition of reservoir solution 2.0 M ammonium sulfate, 5%(v/v) 2-propanol 0.06 M MgCl2, 0.06 M CaCl2, 0.1 M MOPS pH 7.1, 0.1 M HEPES pH 7.1, 15%(v/v) MPD, 15%(w/v) PEG 1000, 15%(w/v) PEG 3350
Volume and ratio of drop 0.4 µl, 1:1 2.0 µl, 1:1
Volume of reservoir (µl) 70 700

Adenylylated GlnK was crystallized using the hanging-drop vapor-diffusion method by mixing 1 µl adGlnK (11 mg ml−1 adGlnK in 20 mM Tris–HCl pH 7.5, 50 mM NaCl, 2 mM MgCl2) with 1 µl reservoir solution and equilibrating against 700 µl reservoir solution at 292 K (Table 2[link]). Diffraction-quality crystals were obtained with a reservoir solution consisting of 0.06 M MgCl2, 0.06 M CaCl2, 0.1 M 3-(N-morpholino)propanesulfonic acid (MOPS) pH 7.1, 0.1 M HEPES pH 7.1, 15%(v/v) 2-methyl-2,4-pentanediol (MPD), 15%(w/v) PEG 1000, 15%(w/v) PEG 3350.

2.3. Data collection and processing

Crystals of unGlnK and adGlnK were flash-cooled in liquid nitrogen using 20%(v/v) ethylene glycol as a cryoprotectant. Diffraction data sets were collected from single crystals at 100 K on synchrotron beamline BL14.2 at BESSY II in Berlin to resolutions of 2.2 and 1.8 Å, respectively (Gerlach et al., 2016[Gerlach, M., Mueller, U. & Weiss, M. S. (2016). J. Large-Scale Res. Facil. 2, A47.]). The data were indexed and integrated with XDS and scaled with XSCALE (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]).

2.4. Structure determination

Initial phases for the unGlnK and adGlnK data sets were obtained via molecular replacement with Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) using the structure of Mycobacterium tuberculosis nitrogen-regulatory PII protein (PDB entry 3bzq; Shetty et al., 2010[Shetty, N. D., Reddy, M. C., Palaninathan, S. K., Owen, J. L. & Sacchettini, J. C. (2010). Protein Sci. 19, 1513-1524.]) and the fully refined unGlnK structure as search models, respectively. The models were completed via alternating cycles of manual building in Coot and automated refinement with Phenix (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]; Liebschner et al., 2019[Liebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861-877.]). The quality of the final models was validated with MolProbity (Chen et al., 2010[Chen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12-21.]).

2.5. Bioinformatics analyses

Structure comparisons and superpositions were computed with either LSQKAB from the CCP4 suite or DALI (Winn et al., 2011[Winn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235-242.]; Holm & Laakso, 2016[Holm, L. & Laakso, L. M. (2016). Nucleic Acids Res. 44, W351-W355.]). Solvent-accessible surface areas were calculated with AREAIMOL, and interaction energies were predicted with the PISA server (Winn et al., 2011[Winn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235-242.]; Krissinel & Henrick, 2007[Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774-797.]). Sequence alignments were calculated with PSI-BLAST and analyzed using the WebLogo server (Crooks et al., 2004[Crooks, G. E., Hon, G., Chandonia, J. M. & Brenner, S. E. (2004). Genome Res. 14, 1188-1190.]; Camacho et al., 2009[Camacho, C., Coulouris, G., Avagyan, V., Ma, N., Papadopoulos, J., Bealer, K. & Madden, T. L. (2009). BMC Bioinformatics, 10, 421.]). Interaction plots were generated with LigPlot+ (Laskowski & Swindells, 2011[Laskowski, R. A. & Swindells, M. B. (2011). J. Chem. Inf. Model. 51, 2778-2786.]). All structure illustrations were produced with UCSF Chimera (Pettersen et al., 2004[Pettersen, E. F., Goddard, T. D., Huang, C. C., Couch, G. S., Greenblatt, D. M., Meng, E. C. & Ferrin, T. E. (2004). J. Comput. Chem. 25, 1605-1612.]).

3. Results

3.1. Crystal structure of unGlnK

The crystal structure of unGlnK from C. glutamicum was determined at 2.2 Å resolution (Fig. 2[link], Tables 3[link] and 4[link]). The protein crystallized in the tetragonal space group P43212 and the final model contains one GlnK trimer per asymmetric unit. Each GlnK subunit spans 112 residues and encompasses the three characteristic loop segments highlighted as important for function of the PII protein (Forcada-Nadal et al., 2018[Forcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.]; Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]). The T-loop (residues 37–55) extends from β-strands β2′ and β3′ and consists of an antiparallel β-finger structure formed by two short β-strands, named β2′′ (residues 42–46) and β3′′ (residues 49–53) that are interconnected by a β-turn with the sequence 46-YRGA-49 (Figs. 1[link]a and 2[link]a, Supplementary Fig. S2). Gly48 at position i + 2 of the β-turn appears to be strictly conserved among PII proteins (Supplementary Figs. S2 and S3). The B-loop interconnects helix α2 and strand β4 and is formed by residues 82-RTG­KVGD-88 (Figs. 1[link]a and 2[link]a). The so-called C-terminal loop (C-loop; residues 102–106) extends from the end of β5 and includes part of β6. The latter strand is then followed by a single 310-helical turn that ends with the C-terminus of the protein. All three chains present in the asymmetric unit could be traced continuously, with the exception of a four-amino-acid gap between residues 37 and 42 at the beginning of the T-loop, for which no electron density is observed in any of the three subunits of trimeric unGlnK (Fig. 2[link]a). Density is also lacking in one subunit for residue 47 located at the tip of the T-loop. The three subunits deviate from each other by an average r.m.s.d. value of 0.6 Å (Cα positions; Supplementary Table S1).

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

  UnGlnK AdGlnK
Diffraction source BL14.2, BESSY II BL14.2, BESSY II
Wavelength (Å) 0.9184 0.9184
Temperature (K) 100 100
Space group P43212 P32
a, b, c (Å) 82.51, 82.51, 170.59 53.44, 54.44, 179.95
α, β, γ (°) 90, 90, 90 90, 90, 120
Mosaicity (°) 0.11 0.41
Resolution range (Å) 48.16–2.20 (2.28–2.20) 22.97–1.80 (1.86–1.80)
Total No. of reflections 265594 (24581) 271662 (27397)
No. of unique reflections 30720 (2999) 53142 (5326)
Completeness (%) 99.9 (100.0) 99.6 (99.8)
Multiplicity 8.6 (8.2) 5.1 (5.1)
〈I/σ(I)〉 15.3 (1.2) 17.5 (1.4)
Rp.i.m. 0.036 (0.645) 0.025 (0.527)
Overall B factor from Wilson plot (Å2) 48.3 30.0

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

  UnGlnK AdGlnK
PDB code 6cy6 6cy7
Resolution range (Å) 48.16–2.20 (2.28–2.20) 22.41–1.80 (1.86–1.80)
Completeness (%) 99.9 (100.0) 99.6 (99.8)
No. of reflections, working set 30714 (2999) 53100 (5325)
No. of reflections, test set 1540 (148) 1288 (123)
Final Rcryst 0.208 (0.308) 0.187 (0.278)
Final Rfree 0.234 (0.326) 0.223 (0.308)
No. of non-H atoms
 Protein 2480 4687
 Ligand 47 93
 Water 54 278
 Total 2581 5086
R.m.s. deviations
 Bond lengths (Å) 0.004 0.009
 Angles (°) 0.57 0.96
Average B factors (Å2)
 Overall 59.0 43.2
 Protein 58.9 43.7
 Ligand 72.7 70.8
 Water 51.0 42.4
Ramachandran plot
 Most favored (%) 98.7 99.5
 Allowed (%) 1.3 0.5
[Figure 2]
Figure 2
The three-dimensional structure of unGlnK and adGlnK from C. glutamicum. (a) Structure of an unGlnK monomer shown in a cartoon representation. The side chain of Tyr51, which is located in the T-loop (residues 37–55), as well as the phosphate ion bound in the ATP-binding pocket, is shown in a stick representation and labeled accordingly. (b) Structure of the unGlnK trimer. Primes and double primes denote residues from the second and third protomers, respectively. (c) Structure of one adGlnK monomer. The side chain of the adenylylated Tyr51, as well as the AMP bound in the ATP-binding pocket, is highlighted in a stick representation. (d) Structure of the adGlnK trimer.

In the GlnK trimer, the secondary-structure elements of the subunits are extensively interlaced (Fig. 2[link]b). The surface area of isolated monomers amounts to 7550 Å2 on average and 2450 Å2 of this area becomes buried upon trimer formation (32% of the total solvent-accessible surface area of each monomer). The dissociation free energy is estimated by the PISA server to amount to 27 kcal mol−1 (Krissinel & Henrick, 2007[Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774-797.]). Hence, and as is the case for other PII proteins, GlnK from C. glutamicum can be considered to be a permanent homotrimeric protein (Jones & Thornton, 1996[Jones, S. & Thornton, J. M. (1996). Proc. Natl Acad. Sci. USA, 93, 13-20.]; Nolden et al., 2001[Nolden, L., Ngouoto-Nkili, C. E., Bendt, A. K., Krämer, R. & Burkovski, A. (2001). Mol. Microbiol. 42, 1281-1295.]). Inspection of the crystal packing suggests that trimeric GlnK further associates into hexamers, and identical hexamers can be observed in the crystal structures of both unGlnK and adGlnK (see below). The hexameric assembly is generated upon the application of a crystallographic twofold rotation along an axis that intersects the noncrystallographic threefold axis of the GlnK trimer at a right angle. Hence, the hexameric assembly displays D3 point-group symmetry (Fig. 1[link]c). In the hexamer, each monomer contributes an additional 850 Å2 of its surface to the oligomer interface. However, only trimers and not hexamers are observed in solution when purifying unGlnK and adGlnK via gel-filtration chromatography (data not shown).

Three phosphate molecules are bound to trimeric GlnK in unGlnK. Each phosphate binds to one of the three effector-binding sites located at the interfaces between the subunits (Figs. 1[link]b and 2[link]). All three phosphates bind highly similarly and interact exclusively with residues from the B- and C-loops. The phosphates form a direct hydrogen bond to the backbone of Gly87 from the B-loop, as well as additional hydrogen bonds to the side chains of Arg101 and Arg103, which either precede or are part of the C-loop (Supplementary Figs. S2 and S4). In addition, water-bridged hydrogen bonds are formed to the backbone atoms of Arg103 and Gly89. These interactions closely resemble the interactions observed in PII proteins when in complex with ATP and, more precisely, the inter­actions formed between the γ-phosphate group of ATP and the PII protein, as for example observed in the ATP-bound structure of the PII protein from Aquifex aeolicus (data not shown; PDB entry 2eg2; Rose et al., 2017[Rose, P. W., Prlić, A., Altunkaya, A., Bi, C., Bradley, A. R., Christie, C. H., Costanzo, L. D., Duarte, J. M., Dutta, S., Feng, Z., Green, R. K., Goodsell, D. S., Hudson, B., Kalro, T., Lowe, R., Peisach, E., Randle, C., Rose, A. S., Shao, C., Tao, Y. P., Valasatava, Y., Voigt, M., Westbrook, J. D., Woo, J., Yang, H., Young, J. Y., Zardecki, C., Berman, H. M. & Burley, S. K. (2017). Nucleic Acids Res. 45, D271-D281.]).

3.2. The GlnK fold and its quaternary structure are shared by many other PII proteins

GlnK from C. glutamicum displays high structural similarity to other PII proteins. Searching the Protein Data Bank with DALI identifies about 80 related entries (Holm & Laakso, 2016[Holm, L. & Laakso, L. M. (2016). Nucleic Acids Res. 44, W351-W355.]). A nonredundant list of the ten closest homologues shows that GlnK from C. glutamicum shares the highest structural similarity with the PII proteins from M. tuberculosis, A. aeolicus, Azospirillum brasilense, Herbaspirillum seropedicae and Synechococcus elongatus, with r.m.s.d. values ranging from 0.9 to 1.9 Å and sequence identities of between 45% and 65% (Supplementary Table S2). A multiple sequence alignment of these 11 structures reveals that, with one minor exception, all segments present in these proteins can be contiguously superimposed without the occurrence of insertions or deletions (Supplementary Fig. S2). The high degree of sequence conservation in PII proteins in general is also apparent from a WebLogo representation of a multiple sequence alignment of as many as 197 different PII proteins (Supplementary Fig. S3; Crooks et al., 2004[Crooks, G. E., Hon, G., Chandonia, J. M. & Brenner, S. E. (2004). Genome Res. 14, 1188-1190.]).

Inspection of the crystal packing of unGlnK and adGlnK revealed the existence of shared hexamers (Fig. 1[link]c). Of the ten closest structural homologues, the PII protein GlnZ from A. brasilense (PDB entry 4co0; Rose et al., 2017[Rose, P. W., Prlić, A., Altunkaya, A., Bi, C., Bradley, A. R., Christie, C. H., Costanzo, L. D., Duarte, J. M., Dutta, S., Feng, Z., Green, R. K., Goodsell, D. S., Hudson, B., Kalro, T., Lowe, R., Peisach, E., Randle, C., Rose, A. S., Shao, C., Tao, Y. P., Valasatava, Y., Voigt, M., Westbrook, J. D., Woo, J., Yang, H., Young, J. Y., Zardecki, C., Berman, H. M. & Burley, S. K. (2017). Nucleic Acids Res. 45, D271-D281.]), the PII protein from Arabidopsis thaliana (PDB entry 2o66; Mizuno et al., 2007[Mizuno, Y., Berenger, B., Moorhead, G. B. G. & Ng, K. K. (2007). Biochemistry, 46, 1477-1483. ]), GlnK1 from Methanocaldococcus jannaschii (PDB entry 2j9d; Yildiz et al., 2007[Yildiz, O., Kalthoff, C., Raunser, S. & Kühlbrandt, W. (2007). EMBO J. 26, 589-599.]) and the PII protein GlnK2 from Archaeoglobus fulgidus (PDB entry 3ncp; Helfmann et al., 2010[Helfmann, S., Lü, W., Litz, C. & Andrade, S. L. A. (2010). J. Mol. Biol. 402, 165-177.]) also form hexameric assemblies (Supplementary Table S2). Hexamers can also be observed in PII proteins extending beyond those identified as closest structural homologs, as is for example the case for the PII protein from Haloferax mediterranei (PDB entry 4ozj; Palanca et al., 2014[Palanca, C., Pedro-Roig, L., Llácer, J. L., Camacho, M., Bonete, M. J. & Rubio, V. (2014). FEBS J. 281, 3299-3314.]). The proteins from C. glutamicum, A. brasilense (PDB entry 4co0) and A. thaliana (PDB entry 2o66) form identical hexamers, and hexamer formation is mediated by residues from the tip of the T-loop and via an antiparallel juxtaposition of two β3′ β-strands belonging to two different protomers and trimers (Fig. 1[link]). Interestingly, in the hexameric assembly observed in GlnK1 from M. jannaschii (PDB entry 2j9d) and GlnK2 from A. fulgidus (PDB entry 3ncp), the same trimer interfaces are juxtaposed; however, the trimers are rotated with respect to each other when compared with the hexamer assembly observed in C. glutamicum. Moreover, in some crystals of ADP-bound GlnZ from A. brasilense (PDB entry 4cnz; Truan et al., 2014[Truan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783-2799.]), trimers of GlnZ assemble into hexamers via the opposite trimer interface (Truan et al., 2014[Truan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783-2799.]). While the biological function of the PII trimers appears to be well established, the significance of these hexameric assemblies currently remains unclear.

3.3. Crystal structure of adGlnK

The crystal structure of adGlnK was determined at 1.8 Å resolution (Fig. 2[link], Tables 3[link] and 4[link]). The protein crystallized in the trigonal space group P32 and the final model contains six proteins chains per asymmetric unit. The six adGlnK protomers form two homotrimers that assemble into a hexamer (Fig. 1[link]c). All six chains share highly similar overall conformations, and the average r.m.s. deviation obtained upon pairwise comparison of all six protomers is 0.33 Å (Supplementary Table S1).

Electron density for the adenylylated Tyr51 residue can be observed in three of the six chains (Fig. 3[link]). The AMP moiety, which is covalently linked to the hydroxyl group of Tyr51, curves back towards the protein backbone, where it is held in place via a hydrogen bond between the carbonyl group of the adjacent residue Ala52 and the terminal amino group of the adenine moiety (Fig. 3[link]d, Supplementary Figs. S2 and S5). Another stabilizing contact, which is conserved in all three modified tyrosines, is a π–π-stacking interaction between the aromatic rings of Tyr51 and Phe11 from an adjacent chain (Fig. 3[link]d). In addition, the phosphate moiety is tethered to the backbone via a network of water-bridged hydrogen bonds (Supplementary Fig. S5).

[Figure 3]
Figure 3
Detailed view of the adenylylated T-loop region (residues 43–55) in (a) chain A (with C atoms colored gray), (b) chain B (colored green) and (c) chain E (colored orange) of the adGlnK hexamer (chains A–F). The 2mFo − DFc electron-density map is shown in blue within a radius of 1.5 Å of any displayed atoms and is contoured at 1σ. (d) Stereo representation of the immediate surroundings of the adenylylated Tyr51 in chain E. Residues from chains B, E and F are colored green, blue and orange, respectively. Potential hydrogen bonds are shown as dotted black lines. The π–π-stacking interaction between the tyrosyl moiety of adTyr51 and Phe11′′ is shown as a dotted red line.

Mass-spectrometric measurements indicate that adGlnK is almost fully adenylylated (Supplementary Fig. S1). However, only three adenylyl moieties could be modeled with confidence in the adGlnK structure. The adenylylated Tyr51 residues are located very close to the twofold rotational symmetry axes that interrelate the trimers in the hexameric assembly (Fig. 1[link]c). If all six Tyr51 residues were modeled as fully adenylylated tyrosines then the pairs of AMP moieties would clash. Hence, only a single AMP moiety was modeled per two Tyr51 residues at each special position, namely the moiety that displayed the most easily interpretable electron density. This observation suggests that in the crystal, at any given point in time three adenylylated tyrosine residues are able to adopt defined conformations, while the other three residues are forced to adopt flexible conformations.

The crystals of adGlnK were assigned space group P32. However, the data could alternatively also be reduced in space group P3221, and a moderate decrease in Rp.i.m. is observed when switching to the higher symmetry space group, namely 1.9% for P3221 versus 2.5% for P32 (Table 3[link] and data not shown). Molecular-replacement calculations yielded identical crystal-packing solutions in both space groups. However, whereas the asymmetric unit contains an entire adGlnK hexamer in space group P32, the asymmetric unit is built up from trimers in space group P3221. In the latter, the hexameric assembly is obtained upon the application of crystallographic twofold symmetry operations that are present in addition in space group P3221. The diffraction data analysis of adGnK was performed in space group P32 since more readily interpretable electron density was observed for the AMP moieties of the adenylylated Tyr51 residues and differences could also be observed with regard to the fortuitously bound effector molecules AMP and ADP in this space group (see below). At the same time, the crystallographic twofold symmetry axes in space group P3221 introduced intermolecular clashes between the AMP moieties of the adenylylated Tyr51 residues (see above). Nonetheless, space group P3221 cannot be fully ruled out as the correct space group at this time since a pairwise comparison of all six adGlnK monomers in P32 shows that those monomer pairs that are related by dyads corresponding to crystallographic dyads in P3221 and noncrystallographic dyads in P32 display a lower r.m.s.d. value (0.12 Å on average) than those interrelated by the noncrystallographic threefold rotational symmetry axis that is present in both space groups (0.39 Å; Supplementary Table S1).

3.4. Fortuitous effector binding in adGlnK

The hexamer that is present in the asymmetric unit of the adGlnK crystals encompasses six effector-binding sites. While four of these sites appear to be devoid of any ligand, fortuitous binding of AMP and ADP was observed in the remaining two binding sites (Supplementary Fig. S6). In both the AMP- and ADP-binding sites, the adenine nucleobase is bound via two hydrogen bonds to the backbone of Ile64 from strand β3 and via one hydrogen bond to the side chain of Thr29 displayed from strand β2. Thr29 further forms a hydrogen bond to the hydroxyl group attached to atom C2′ of the ribose moiety of AMP or ADP (Supplementary Figs. S6 and S7). This interaction pattern between the nucleoside moiety and the PII protein is highly conserved among AMP-, ADP- and ATP-bound PII proteins and can, for example, also be found in the AMP-bound structure of SbtB from Cyanobacterium sp. 7001 (PDB entry 6mmo; Kaczmarski et al., 2019[Kaczmarski, J. A., Hong, N., Mukherjee, B., Wey, L. T., Rourke, L., Förster, B., Peat, T. S., Price, G. D. & Jackson, C. J. (2019). Biochemistry, 58, 5030-5039.]) and the ADP-bound structure of GlnK2 from H. mediterranei (PDB entry 4ozj; Palanca et al., 2014[Palanca, C., Pedro-Roig, L., Llácer, J. L., Camacho, M., Bonete, M. J. & Rubio, V. (2014). FEBS J. 281, 3299-3314.]), as well as in the ATP-bound structure of the PII protein from A. aeolicus (PDB entry 2eg2; Rose et al., 2017[Rose, P. W., Prlić, A., Altunkaya, A., Bi, C., Bradley, A. R., Christie, C. H., Costanzo, L. D., Duarte, J. M., Dutta, S., Feng, Z., Green, R. K., Goodsell, D. S., Hudson, B., Kalro, T., Lowe, R., Peisach, E., Randle, C., Rose, A. S., Shao, C., Tao, Y. P., Valasatava, Y., Voigt, M., Westbrook, J. D., Woo, J., Yang, H., Young, J. Y., Zardecki, C., Berman, H. M. & Burley, S. K. (2017). Nucleic Acids Res. 45, D271-D281.]). Moreover, Thr29 is among the most highly conserved residues in PII proteins (Supplementary Fig. S3).

In the AMP-binding site of adGlnK, the α-phosphate group forms two direct hydrogen bonds to the backbone N atoms of Gly87 and Gly89 displayed from the B-loop and in addition an indirect and water-bridged hydrogen-bond interaction with the side chain of Arg101 from the C-loop (Supplementary Figs. S6a and S7a). With some variations, this α-phosphate-binding mode is also highly conserved among PII proteins. However, in some PII proteins, such as for example SbtB from Cyanobacterium sp. 7001 (PDB entry 6mmo), the α-phosphate group interacts with side chains from residues displayed from strand β4 rather than from the preceding B-loop (data not shown).

In the ADP-bound effector-binding site the α-phosphate group is slightly displaced, and of the two glycines Gly87 and Gly89, the α-phosphate group forms only a single hydrogen bond to Gly87, while the additional β-phosphate moiety interacts via a water-bridged hydrogen bond with the side chain of Lys58 from β-strand β3 located at the end of the T-loop (Supplementary Figs. S6b and S7b). While this kind of interaction mirrors that in the binding of ADP to GlnK2 from H. mediterranei (PDB entry 4ozj; Palanca et al., 2014[Palanca, C., Pedro-Roig, L., Llácer, J. L., Camacho, M., Bonete, M. J. & Rubio, V. (2014). FEBS J. 281, 3299-3314.]), in other ADP-bound PII proteins the terminal phosphate is often bound directly by one to three serine residues displayed from strand β4 and, more importantly, by residues from the T-loop (data not shown). Moreover, in the latter proteins the tight interactions between ADP and the T-loop appear to stabilize a specific T-loop conformation that is characterized by a Gln39–Lys58 side-chain interaction (Truan et al., 2010[Truan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531-539.]). This conformation is often referred to as the canonical ADP-bound T-loop conformation and is distinct from that observed in the absence of bound nucleotides (Truan et al., 2014[Truan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783-2799.]). In the case of adGlnK, however, residue Gln39 cannot be modeled and no differences in the conformation of the T-loop can be observed, irrespective of whether the effector-binding site is empty or is occupied by AMP or ADP (see below).

Of the six T-loops present in the six PII monomers in the asymmetric unit of the adGlnK crystals, a considerably higher number of T-loop residues could be modeled in those loops in which the adenylylated Tyr51 residues are clearly resolved, and a considerably lower number of T-loop residues are visible in the two monomers where the effector-binding site is occupied by either AMP or ADP (Supplementary Fig. S8). This observation suggests that nucleotide binding possibly increases the conformational flexibility of the adenylylated T-loop and is in line with a similar observation for uridylylated GlnB from E. coli (Palanca & Rubio, 2017[Palanca, C. & Rubio, V. (2017). Environ. Microbiol. Rep. 9, 290-299.]). In uridylylated GlnB from E. coli, the effector-binding site is occupied by ATP, and similarly to the binding of AMP and ADP to GlnK, only the base of the T-loop is ordered (Supplementary Fig. S8c). At the same time, in both adenylylated GlnK and uridylylated GlnB the nucleotides bind to the respective PII protein in a highly similar fashion (Supplementary Fig. S8).

3.5. Structural comparison between unGlnK and adGlnk

The overall fold of the monomers and the assembly of trimers and hexamers are virtually identical in unGlnK and adGlnK. A cross-comparison of the monomers from the unGlnK and adGlnK crystals shows that the r.m.s.d. values (0.49 Å on average) are almost identical to those obtained when superimposing unGlnK or adGlnK monomers separately (0.6 and 0.33 Å, respectively, see above; Supplementary Table S1).

Such a high degree of similarity is to be expected for the core regions of the GlnK trimers, given the level of structural conservation among PII proteins. However, a close inspection of the T-loops also reveals a highly similar overall positioning of the T-loop in all nine independently observed monomers, namely in the three monomers in the unGlnK crystal structure and the six monomers in adGlnK (Fig. 4[link]). In addition, the presence or absence of ligands, whether it be phosphate ions, AMP or ADP, appears to have little effect on the conformation of the T-loop in the present structures. This also holds true for the adenylylation of Tyr51, which also does not appear to affect the conformation of the T-loop. The only sizeable difference between the different monomers is that in the presence of a bound AMP or ADP molecule a lower number of T-loop residues can be modeled in the respective protomers (Fig. 4[link] and Supplementary Fig. S8).

[Figure 4]
Figure 4
T-loop conformations in unGlnK and adGlnK. Superposition of the T-loops from (a) all three monomers in the unGlnK trimer, (b) all six monomers present in adGlnK and (c) all monomers from both unGlnK and adGlnK. In all panels the T-loops were superimposed using the coordinates of the entire monomers.

4. Discussion

In this work, a protocol for the production of adenylylated adGlnK has been established. While the present study focuses on the determination of the crystal structures of adGlnK and unGlnK, the high yields obtained for adGlnK will greatly facilitate future additional in-depth characterizations of adGlnK. The post-translationally adenylylated Tyr51 residue is well resolved in the crystal structure of adGlnK, and the atomic interactions formed between the AMP moiety and the T-loop can be observed in great detail. So far, this has not been possible for any other post-translationally modified PII protein. For example, in the crystal structure of uridylylated GlnB from E. coli, local disorder prevented the modeling of the uridylylated tyrosine residue (Palanca & Rubio, 2017[Palanca, C. & Rubio, V. (2017). Environ. Microbiol. Rep. 9, 290-299.]).

In addition to the post-translational modification, three fortuitously bound ligands were observed in the effector-binding sites of both unGlnK and adGlnK. In unGlnK all three effector-binding pockets were occupied by single phosphate molecules, and in adGlnK two of the six binding pockets were occupied by either AMP or ADP despite the fact that no nucleotides were added to the crystallization buffer. It is possible that the presence of AMP and ADP in adGlnK hints at differences in the effector-binding affinities between adGlnK and unGlnK. However, such an interpretation must be made with caution since the two proteins were produced in different bacterial expression systems using different media and purification protocols. Interestingly, in the crystal structure of uridylylated GlnB from E. coli, ATP was bound in the effector-binding site. In contrast to adGlnK, however, ATP was deliberately added to the crystallization solution of uridylylated GlnB (Palanca & Rubio, 2017[Palanca, C. & Rubio, V. (2017). Environ. Microbiol. Rep. 9, 290-299.]). The question as to whether adenylylation alters the nucleotide-binding affinity of GlnK (or likewise whether uridylylation alters the affinity of GlnB) is certainly of importance when aiming at better understanding the function of GlnK (and GlnB), but would require the determination of the exact effector-binding affinities. These experiments could also help to clarify whether AMP is a genuine effector of GlnK from C. glutamicum.

Depending on the nature of the bound ligands, the T-loop adopts distinct and specific conformations in PII proteins (Truan et al., 2014[Truan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783-2799.]). Of particular interest are the extended conformation that is adopted upon binding ADP and the compacted conformation that is induced upon the binding of Mg-ATP and 2OG. While the ADP-bound conformation promotes the binding of PII proteins to interaction partners, the formation of the complex with Mg-ATP and 2OG abrogates binding in general (Fokina et al., 2010[Fokina, O., Chellamuthu, V. R., Forchhammer, K. & Zeth, K. (2010). Proc. Natl Acad. Sci. USA, 107, 19760-19765.]; Truan et al., 2010[Truan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531-539.]; Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]). The so-called canonical ADP-bound conformation is observed in the crystal structures of complexes formed between the PII protein GlnZ and DraG, GlnK and AmtB and in the PII–PipX complex, while in the only other additionally structurally characterized complex, namely that of PII in complex with NagK, ATP alone was present in the effector-binding site of the PII protein (Forcada-Nadal et al., 2018[Forcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.]; Forchhammer & Selim, 2020[Forchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33-53.]).

The T-loop conformations observed in unGlnK and adGlnK resemble the canonical ADP-bound conformation, albeit with some differences (Figs. 4[link] and 5[link]). Whereas residues 38–41, which are located at the base of the T-loop, are disordered in unGlnK and adGlnK, these residues are well ordered in the canonical ADP-bound conformation and directly participate in ADP binding, as for example observed in the ADP-bound complex of GlnZ from A. brasil­ense (Fig. 5[link]; Truan et al., 2014[Truan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783-2799.]). A direct comparison of the residues located within 4.5 Å of any ADP atom in GlnZ with the corresponding residues in GlnK from C. glutamicum suggests that GlnK should be able to adopt the canonical ADP-bound conformation, since sequence differences mainly occur in residues that contribute to ADP binding in A. brasilense via main-chain interactions (data not shown) (Fig. 5[link]c). Moreover, adenylyl­ation of Tyr51 also does not appear to interfere with the conformation of the T-loop; hence, adGlnK and unGlnK should be equally capable of adopting the canonical ADP-bound conformation (Fig. 5[link]a).

[Figure 5]
Figure 5
Comparison of effector binding and T-loop conformation between adGlnK from C. glutamicum and GlnZ from A. brasilense. (a) Superposition of adGlnK (in green) and ADP-bound GlnZ (red; PDB entry 4co1; Truan et al., 2014[Truan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783-2799.]). (b) Superposition of adGlnK (in green) and Mg-ATP and 2OG-bound GlnZ (blue; PDB entry 3mhy; Truan et al., 2010[Truan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531-539.]). For clarity, only a single subunit is shown and hence the contribution of the B- and C-loop residues to effector binding is not shown. (c) Sequence alignment between GlnK and GlnZ. Residues located within 4.5 Å of any bound effector atom are highlighted in red, blue and yellow when involved solely in ADP binding, solely in Mg-ATP/2OG binding or in binding both ADP and Mg-ATP/2OG, respectively

Of similar importance for PII function is the compacted T-loop conformation observed in PII proteins bound to Mg-ATP and 2OG (Truan et al., 2010[Truan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531-539.]; Fig. 5[link]b). All attempts to crystallize a ternary complex consisting of Mg-ATP, 2OG and either unGlnK or adGlnK, however, have so far failed. Considerations similar to those discussed above for the canonical ADP-bound conformation strongly suggest that GlnK from C. glutamicum is likely to bind Mg-ATP and 2OG, and moreover is also able to adopt a similar compacted T-loop conformation. The sequence identity is very high between the residues directly involved in effector binding, as exemplified by comparing the Mg-ATP and 2OG complex of GlnZ from A. brasilense with GlnK from C. glutamicum (Fig. 5[link]c; Truan et al., 2010[Truan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531-539.]). The most pronounced sequence difference is the substitution of Arg38 in GlnZ by glutamine in GlnK. In GlnZ, the main-chain NH group of Arg38 directly interacts with the β-phosphate of ATP, while its guanidino group interacts with the γ-phosphate. From this, it appears likely that Gln38 in GlnK can take over the role of Arg38 in GlnZ in ATP binding. Interestingly, adenylylation of Tyr51 is also not expected to interfere with the T-loop conformation in the case of the compacted conformation, since Tyr51 remains fully accessible at the protein surface (Fig. 5[link]b).

In all presently structurally characterized PII-protein complexes, post-translational modification of the PII protein either abrogated binding to a partner protein, as seen for example for the interaction of GlnK with AmtB in E. coli upon the uridylylation of GlnK and for the interaction of S. elongatus PII with NAGK upon the phosphorylation of S. elongatus PII, or had no effect on the interaction, as for example proposed for the PII–PipX interaction upon the phosphorylation of PII residue Ser49 (Merrick, 2014[Merrick, M. (2014). Front. Microbiol. 5, 763.]). In the case of GlnK from C. glutamicum, it has been proposed that adenylylation of Tyr51 is a prerequisite for the interaction of GlnK with its binding partner, namely the bacterial repressor protein AmtR (Beckers et al., 2005[Beckers, G., Strösser, J., Hildebrandt, U., Kalinowski, J., Farwick, M., Krämer, R. & Burkovski, A. (2005). Mol. Microbiol. 58, 580-595.]). AmtR functions as a global repressor and regulates the transcription of multiple genes involved in nitrogen metabolization (Jakoby et al., 2000[Jakoby, M., Nolden, L., Meier-Wagner, J., Krämer, R. & Burkovski, A. (2000). Mol. Microbiol. 37, 964-977.]). In this context, adGlnK has been proposed to function as an inducer of AmtR and to alleviate gene repression by abrogating DNA operator binding of AmtR (Beckers et al., 2005[Beckers, G., Strösser, J., Hildebrandt, U., Kalinowski, J., Farwick, M., Krämer, R. & Burkovski, A. (2005). Mol. Microbiol. 58, 580-595.]). Based on the crystal structure of C. glutamicum AmtR, a model for interaction of AmtR with adGlnK has been proposed. In this model, two adGlnK trimers bind to an AmtR hexamer and block the binding of the AmtR operator (Sevvana et al., 2017[Sevvana, M., Hasselt, K., Grau, F. C., Burkovski, A. & Muller, Y. A. (2017). Acta Cryst. F73, 146-151.]).

A similar model has also been proposed for the interaction of E. coli GlnB with glutamine synthetase adenylyl transferease (ATase; Palanca & Rubio, 2017[Palanca, C. & Rubio, V. (2017). Environ. Microbiol. Rep. 9, 290-299.]). In the case of GlnB, uridylylation of Tyr51 is a prerequisite for complex formation. Interestingly, in both adenylylated GlnK and uridylylated GlnB, post-translational modification of the PII protein does not engender defined conformational rearrangements in the respective PII protein, hinting that complex formation is not modulated by an allosteric mechanism but that rather direct atomic interactions between the adenylylated Tyr51 of adGlnK and AmtR as well as between the uridylylated Tyr51 of GlnB and ATase promote complex formation (Palanca & Rubio, 2017[Palanca, C. & Rubio, V. (2017). Environ. Microbiol. Rep. 9, 290-299.]).

So far, however, it has not been possible to reconstitute an adGlnk–AmtR complex in vitro, irrespective of whether or not additional effector molecules were present. Neither the addition of millimolar concentrations of ADP, ATP alone or ATP together with 2OG resulted in the formation of an adGlnK–AmtR complex that could be monitored by gel-filtration chromatography or observed in pull-down assays. Clearly, further experiments are needed to further understand the function of adGlnK.

Supporting information


Acknowledgements

We would like to thank Max Kraner and Uwe Sonnewald for help with the mass-spectrometric analysis of adGlnK and Manfred Weiss and Uwe Müller and their team at HZB for help with diffraction data collection at the BESSY synchrotron. We would further like to thank Marwa Azzam (Division of Microbiology, Friedrich-Alexander-Universität), Andreas Kugemann and Steffen Docter (both from the Division of Biotechnology, Friedrich-Alexander-Universität) for technical assistance. We would also like to thank the anonymous reviewers. Their comments helped us to revise and further focus the discussion section of the manuscript. Open access funding enabled and organized by Projekt DEAL.

Funding information

This study was financed by intramural funding only.

References

First citationBeckers, G., Strösser, J., Hildebrandt, U., Kalinowski, J., Farwick, M., Krämer, R. & Burkovski, A. (2005). Mol. Microbiol. 58, 580–595.  Web of Science CrossRef PubMed CAS Google Scholar
First citationCamacho, C., Coulouris, G., Avagyan, V., Ma, N., Papadopoulos, J., Bealer, K. & Madden, T. L. (2009). BMC Bioinformatics, 10, 421.  Google Scholar
First citationChen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12–21.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationCrooks, G. E., Hon, G., Chandonia, J. M. & Brenner, S. E. (2004). Genome Res. 14, 1188–1190.  Web of Science CrossRef PubMed CAS Google Scholar
First citationDusch, N., Pühler, A. & Kalinowski, J. (1999). Appl. Environ. Microbiol. 65, 1530–1539.  CrossRef PubMed CAS Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFokina, O., Chellamuthu, V. R., Forchhammer, K. & Zeth, K. (2010). Proc. Natl Acad. Sci. USA, 107, 19760–19765.  Web of Science CrossRef CAS PubMed Google Scholar
First citationForcada-Nadal, A., Llácer, J. L., Contreras, A., Marco-Marín, C. & Rubio, V. (2018). Front. Mol. Biosci. 5, 91.  PubMed Google Scholar
First citationForchhammer, K. & Selim, K. A. (2020). FEMS Microbiol. Rev. 44, 33–53.  CAS PubMed Google Scholar
First citationGerlach, M., Mueller, U. & Weiss, M. S. (2016). J. Large-Scale Res. Facil. 2, A47.  Google Scholar
First citationHelfmann, S., Lü, W., Litz, C. & Andrade, S. L. A. (2010). J. Mol. Biol. 402, 165–177.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHolm, L. & Laakso, L. M. (2016). Nucleic Acids Res. 44, W351–W355.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHuergo, L. F., Souza, E. M., Steffens, M. B., Yates, M. G., Pedrosa, F. O. & Chubatsu, L. S. (2003). FEMS Microbiol. Lett. 223, 33–40.  CrossRef PubMed CAS Google Scholar
First citationJakoby, M., Nolden, L., Meier-Wagner, J., Krämer, R. & Burkovski, A. (2000). Mol. Microbiol. 37, 964–977.  Web of Science CrossRef PubMed CAS Google Scholar
First citationJones, S. & Thornton, J. M. (1996). Proc. Natl Acad. Sci. USA, 93, 13–20.  CrossRef CAS PubMed Web of Science Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKaczmarski, J. A., Hong, N., Mukherjee, B., Wey, L. T., Rourke, L., Förster, B., Peat, T. S., Price, G. D. & Jackson, C. J. (2019). Biochemistry, 58, 5030–5039.  CrossRef CAS PubMed Google Scholar
First citationKeilhauer, C., Eggeling, L. & Sahm, H. (1993). J. Bacteriol. 175, 5595–5603.  CrossRef CAS PubMed Google Scholar
First citationKrissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774–797.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLaemmli, U. K. (1970). Nature, 227, 680–685.  CrossRef CAS PubMed Web of Science Google Scholar
First citationLaskowski, R. A. & Swindells, M. B. (2011). J. Chem. Inf. Model. 51, 2778–2786.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMerrick, M. (2014). Front. Microbiol. 5, 763.  PubMed Google Scholar
First citationMizuno, Y., Berenger, B., Moorhead, G. B. G. & Ng, K. K. (2007). Biochemistry, 46, 1477–1483.   CrossRef PubMed CAS Google Scholar
First citationNolden, L., Ngouoto-Nkili, C. E., Bendt, A. K., Krämer, R. & Burkovski, A. (2001). Mol. Microbiol. 42, 1281–1295.  Web of Science CrossRef PubMed CAS Google Scholar
First citationPalanca, C., Pedro-Roig, L., Llácer, J. L., Camacho, M., Bonete, M. J. & Rubio, V. (2014). FEBS J. 281, 3299–3314.  Web of Science CrossRef CAS PubMed Google Scholar
First citationPalanca, C. & Rubio, V. (2016). FEBS J. 283, 1039–1059.  Web of Science CrossRef CAS PubMed Google Scholar
First citationPalanca, C. & Rubio, V. (2017). Environ. Microbiol. Rep. 9, 290–299.  CrossRef CAS PubMed Google Scholar
First citationPettersen, E. F., Goddard, T. D., Huang, C. C., Couch, G. S., Greenblatt, D. M., Meng, E. C. & Ferrin, T. E. (2004). J. Comput. Chem. 25, 1605–1612.  Web of Science CrossRef PubMed CAS Google Scholar
First citationRose, P. W., Prlić, A., Altunkaya, A., Bi, C., Bradley, A. R., Christie, C. H., Costanzo, L. D., Duarte, J. M., Dutta, S., Feng, Z., Green, R. K., Goodsell, D. S., Hudson, B., Kalro, T., Lowe, R., Peisach, E., Randle, C., Rose, A. S., Shao, C., Tao, Y. P., Valasatava, Y., Voigt, M., Westbrook, J. D., Woo, J., Yang, H., Young, J. Y., Zardecki, C., Berman, H. M. & Burley, S. K. (2017). Nucleic Acids Res. 45, D271–D281.  CAS PubMed Google Scholar
First citationSevvana, M., Hasselt, K., Grau, F. C., Burkovski, A. & Muller, Y. A. (2017). Acta Cryst. F73, 146–151.  CrossRef IUCr Journals Google Scholar
First citationShetty, N. D., Reddy, M. C., Palaninathan, S. K., Owen, J. L. & Sacchettini, J. C. (2010). Protein Sci. 19, 1513–1524.  CrossRef CAS PubMed Google Scholar
First citationStrösser, J., Lüdke, A., Schaffer, S., Krämer, R. & Burkovski, A. (2004). Mol. Microbiol. 54, 132–147.  Web of Science PubMed Google Scholar
First citationThe UniProt Consortium (2017). Nucleic Acids Res. 45, D158–D169.  Web of Science CrossRef PubMed Google Scholar
First citationTruan, D., Bjelić, S., Li, X.-D. & Winkler, F. K. (2014). J. Mol. Biol. 426, 2783–2799.  CrossRef CAS PubMed Google Scholar
First citationTruan, D., Huergo, L. F., Chubatsu, L. S., Merrick, M., Li, X.-D. & Winkler, F. K. (2010). J. Mol. Biol. 400, 531–539.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWinn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationYildiz, O., Kalthoff, C., Raunser, S. & Kühlbrandt, W. (2007). EMBO J. 26, 589–599.  Web of Science CrossRef PubMed CAS Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983
Follow Acta Cryst. D
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds