research papers\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983

Protein–macrocycle polymorphism: crystal form IV of the Ralstonia solanacearum lectin–sulfonato-calix[8]arene complex

crossmark logo

aSchool of Biological and Chemical Sciences, University of Galway, University Road, Galway H91 TK33, Ireland
*Correspondence e-mail: [email protected]

Edited by E. F. Garman, University of Oxford, United Kingdom (Received 24 January 2023; accepted 28 April 2023; online 14 June 2023)

Controlled protein assembly and crystallization is necessary as a means of generating diffraction-quality crystals as well as providing a basis for new types of biomaterials. Water-soluble calixarenes are useful mediators of protein crystallization. Recently, it was demonstrated that Ralstonia solanacearum lectin (RSL) co-crystallizes with anionic sulfonato-calix[8]arene (sclx8) in three space groups. Two of these co-crystals only grow at pH ≤ 4 where the protein is cationic, and the crystal packing is dominated by the calixarene. This paper describes a fourth RSL–sclx8 co-crystal, which was discovered while working with a cation-enriched mutant. Crystal form IV grows at high ionic strength in the pH range 5–6. While possessing some features in common with the previous forms, the new structure reveals alternative calixarene binding modes. The occurrence of C2-symmetric assemblies, with the calixarene at special positions, appears to be an important result for framework fabrication. Questions arise regarding crystal screening and exhaustive searching for polymorphs.

1. Introduction

In a recent editorial, Desiraju remarked on the conceptual shift from the structure to a structure, the latter being a point in the crystal-engineering landscape of a small molecule (Desiraju, 2021[Desiraju, G. R. (2021). IUCrJ, 8, 148-149.]). Notwithstanding some discussion regarding definitions (Jones & Ulrich, 2010[Jones, M. J. & Ulrich, J. (2010). Chem. Eng. Technol. 33, 1571-1576.]; Ulrich & Pietzsch, 2015[Ulrich, J. & Pietzsch, M. (2015). Cryst. Res. Technol. 50, 560-565.]), protein crystal polymorphism is a well recognized phenomenon (Ebrahim et al., 2019[Ebrahim, A., Appleby, M. V., Axford, D., Beale, J., Moreno-Chicano, T., Sherrell, D. A., Strange, R. W., Hough, M. A. & Owen, R. L. (2019). Acta Cryst. D75, 151-159.]; Gillespie et al., 2014[Gillespie, C. M., Asthagiri, D. & Lenhoff, A. M. (2014). Cryst. Growth Des. 14, 46-57.]; Lanza et al., 2019[Lanza, A., Margheritis, E., Mugnaioli, E., Cappello, V., Garau, G. & Gemmi, M. (2019). IUCrJ, 6, 178-188.]; Van Driessche et al., 2018[Van Driessche, A. E. S., Van Gerven, N., Bomans, P. H. H., Joosten, R. R. M., Friedrich, H., Gil-Carton, D., Sommerdijk, N. A. J. M. & Sleutel, M. (2018). Nature, 556, 89-94.]). The tetrameric D-glucose isomerase (∼180 kDa) crystallizes in space group I222 or P21212 under low or high precipitant concentrations, respectively (Gillespie et al., 2014[Gillespie, C. M., Asthagiri, D. & Lenhoff, A. M. (2014). Cryst. Growth Des. 14, 46-57.]; Van Driessche et al., 2018[Van Driessche, A. E. S., Van Gerven, N., Bomans, P. H. H., Joosten, R. R. M., Friedrich, H., Gil-Carton, D., Sommerdijk, N. A. J. M. & Sleutel, M. (2018). Nature, 556, 89-94.]; Vuolanto et al., 2003[Vuolanto, A., Uotila, S., Leisola, M. & Visuri, K. (2003). J. Cryst. Growth, 257, 403-411.]). Despite differences in the crystallization mechanisms, either ammonium sulfate (salting-out) or polyethylene glycol (depletion attraction) can act as the precipitant. Chicken egg-white lysozyme (∼14 kDa), which is possibly the best crystallographically characterized protein, with ∼1000 entries in the Protein Data Bank (PDB), crystallizes in at least six space groups (most frequently in P43212), with some evidence that anion binding can select the space group (Lanza et al., 2019[Lanza, A., Margheritis, E., Mugnaioli, E., Cappello, V., Garau, G. & Gemmi, M. (2019). IUCrJ, 6, 178-188.]; Plaza-Garrido et al., 2018[Plaza-Garrido, M., Salinas-Garcia, M. C. & Camara-Artigas, A. (2018). Acta Cryst. D74, 480-489.]; Vaney et al., 2001[Vaney, M. C., Broutin, I., Retailleau, P., Douangamath, A., Lafont, S., Hamiaux, C., Prangé, T., Ducruix, A. & Riès-Kautt, M. (2001). Acta Cryst. D57, 929-940.]; Zalar et al., 2023[Zalar, M., Bye, J. & Curtis, R. (2023). J. Am. Chem. Soc. 145, 929-943.]). Co-crystals of the polyanionic sulfonato-calix[4]arene with lysozyme or methylated lysozyme reveal the polyanion to play key roles in the crystal packing (McGovern et al., 2014[McGovern, R. E., McCarthy, A. A. & Crowley, P. B. (2014). Chem. Commun. 50, 10412-10415.], 2015[McGovern, R. E., Snarr, B. D., Lyons, J. A., McFarlane, J., Whiting, A. L., Paci, I., Hof, F. & Crowley, P. B. (2015). Chem. Sci. 6, 442-449.]).

Calix[n]arenes are macrocyclic polyphenols with extensive crystal-engineering applications (Atwood et al., 2002[Atwood, J. L., Barbour, L. J., Jerga, A. & Schottel, B. L. (2002). Science, 298, 1000-1002.]; Kravets et al., 2021[Kravets, K., Kravets, M., Kędra, K. & Danylyuk, O. (2021). Supramol. Chem. 33, 666-676.]; Leśniewska et al., 2019[Leśniewska, B., Coleman, A. W., Perret, F. & Suwińska, K. (2019). Cryst. Growth Des. 19, 1695-1708.]; Pasquale et al., 2012[Pasquale, S., Sattin, S., Escudero-Adán, E. C., Martínez-Belmonte, M. & de Mendoza, J. (2012). Nat. Commun. 3, 785.]). The sulfonato-calixarenes are versatile receptors for protein surfaces (with millimolar to micromolar binding affinities), acting as molecular glues with pronounced co-crystallization properties akin to `silver bullets' (Alex et al., 2019[Alex, J. M., Rennie, M. L., Engilberge, S., Lehoczki, G., Dorottya, H., Fizil, Á., Batta, G. & Crowley, P. B. (2019). IUCrJ, 6, 238-247.]; McPherson & Cudney, 2006[McPherson, A. & Cudney, B. (2006). J. Struct. Biol. 156, 387-406.]). As mediators of controlled assembly, calixarenes can contribute to the fabrication of protein-based materials (Engilberge et al., 2019[Engilberge, S., Rennie, M. L., Dumont, E. & Crowley, P. B. (2019). ACS Nano, 13, 10343-10350.]; Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]; Rennie et al., 2018[Rennie, M. L., Fox, G. C., Pérez, J. & Crowley, P. B. (2018). Angew. Chem. Int. Ed. 57, 13764-13769.]; Zhu et al., 2021[Zhu, J., Avakyan, N., Kakkis, A., Hoffnagle, A. M., Han, K., Li, Y., Zhang, Z., Choi, T. S., Na, Y., Yu, C. J. & Tezcan, F. A. (2021). Chem. Rev. 121, 13701-13796.]). The controlled formation of stable, porous protein assemblies may be an enabling technology in the development of biocatalysts (Nguyen et al., 2021[Nguyen, T. K., Abe, S., Kasamatsu, M., Maity, B., Yamashita, K., Hirata, K., Kojima, M. & Ueno, T. (2021). ACS Appl. Nano Mater. 4, 1672-1681.]). Previously, we reported three co-crystal forms of sulfonato-calix[8]arene (sclx8, 1.5 kDa; Fig. 1[link]) and cationic yeast cytochrome c (∼13 kDa) (Engilberge et al., 2019[Engilberge, S., Rennie, M. L., Dumont, E. & Crowley, P. B. (2019). ACS Nano, 13, 10343-10350.]; Rennie et al., 2018[Rennie, M. L., Fox, G. C., Pérez, J. & Crowley, P. B. (2018). Angew. Chem. Int. Ed. 57, 13764-13769.]). One of these co-crystal forms is highly porous with ∼85% solvent content and is mediated exclusively by the macrocycle. The crystal packing is devoid of protein–protein contacts. We have also reported three co-crystal forms of sclx8 and the bacterial lectin Ralstonia solanacearum lectin (RSL; ∼29 kDa) (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). Two of these co-crystals are highly porous and rely on protein–calixarene–protein interfaces. Seemingly, sclx8 mediates different protein frameworks (or polymorphs) and functions as a tool for supramolecular isomerism consistent with `the existence of more than one type of network superstructure for the same molecular building blocks' (Moulton & Zaworotko, 2001[Moulton, B. & Zaworotko, M. J. (2001). Chem. Rev. 101, 1629-1658.]).

[Figure 1]
Figure 1
The sulfonato-calix[8]arene (sclx8) macrocycle with sodium counterions.

RSL has a trimeric, six-bladed β-propeller structure with C3 symmetry, an isoelectric point (pI) close to neutral and high thermal stability (Kostlánová et al., 2005[Kostlánová, N., Mitchell, E. P., Lortat-Jacob, H., Oscarson, S., Lahmann, M., Gilboa-Garber, N., Chambat, G., Wimmerová, M. & Imberty, A. (2005). J. Biol. Chem. 280, 27839-27849.]). Table 1[link] lists the three previously described crystal forms of RSL and sclx8 (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). Forms I and II were obtained using a commercial crystallization screen. Form III was originally obtained in an NMR sample (pH 4, no precipitant) after overnight storage in the fridge. Form I, a densely packed crystal in space group P213, grows at high ammonium sulfate concentrations and over a wide pH range. The requirement for high salt and the absence of pH dependence suggests that the hydrophobic effect dominates the formation of protein–calixarene and protein–protein interfaces. Crystal forms II (space group I23) and III (space group P3) grow at pH ≤ 4 where RSL is cationic, and charge–charge interactions are expected to dominate. Both forms II and III are porous and mediated exclusively by sclx8, with no protein–protein interfaces, emphasizing the molecular-glue capacity of sclx8. Each of the three RSL–sclx8 co-crystal forms involve calixarene binding by the key residues Val13 and Lys34, albeit with differences in the calixarene conformation.

Table 1
RSL–sclx8 co-crystal forms and crystallization conditions

Form [Salt] (M) I (M) pH Space group PDB code§ a, b, c (Å) sclx8 share SC†† (%) Pore diameter‡‡ (nm)
I ≥1.6 ≥4.8 4.8–9.5 P213 6z60 64, 64, 64 9 36 1.7
II 0.8–1.0 2.4–3.0 ≤4.0 I23 6z5g 104, 104, 104 12 66 4.2
III None ∼0.1 ≤4.2 P3 6z5q 60, 60, 64 6 59 2.8
IV 1.0–1.2 >4 5.0–6.0 H32 8c9z 76, 76, 114 9 51 2.7
†Approximate concentration of ammonium sulfate (forms I and II) or sodium citrate (form IV) at 1 mM protein.
‡Approximate ionic strength of reservoir components.
§Representative PDB entries.
¶The number of sclx8 molecules per RSL trimer in the crystal packing.
††Solvent content estimated from total mass (protein plus sclx8).
‡‡Diameter of the widest pore calculated in MAP_CHANNELS.

In our previous study, several mutants and chemical modifications of RSL were also tested (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). The mutant MK-RSL with an extended N-terminus containing the Met–Lys motif that binds cucurbit[6]uril (Ramberg, Engilberge, Guagnini et al., 2021[Ramberg, K. O., Engilberge, S., Guagnini, F. & Crowley, P. B. (2021). Org. Biomol. Chem. 19, 837-844.]) was hypothesized to bind sclx8. Trials using the form III co-crystallization condition were unsuccessful. The present work picked up at this point and a broad co-crystallization screen of MK-RSL and sclx8 led to the discovery of form IV, which also occurs with native RSL. Interestingly, the calixarenes are at special positions on crystallographic twofold axes. Calixarene binding at Val13 and Lys34 reoccurs but in a substantially altered format. The role of protein charge and pH screening is discussed in the context of the protein–macrocycle crystallization landscape.

2. Materials and methods

2.1. Materials

Stock solutions of sclx8 (Tokyo Chemical Industry) were prepared in water and the pH was adjusted to 7.5. RSL and MK-RSL, produced in Escherichia coli BL21 cells, were purified and quantified as described previously (Ramberg, Engilberge, Guagnini et al., 2021[Ramberg, K. O., Engilberge, S., Guagnini, F. & Crowley, P. B. (2021). Org. Biomol. Chem. 19, 837-844.]; Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). Each protein was studied in the D-fructose-bound form.

2.2. Co-crystallization trials

Solutions of ∼1 mM RSL in water or MK-RSL in 20 mM potassium phosphate, 50 mM NaCl pH 6.0 were co-crystallized with sclx8 at 20°C. MK-RSL was tested with 4, 16 or 32 mM sclx8 via sitting-drop vapour-diffusion experiments in MRC plates. Drops were prepared with a commercial screen (JBScreen JCSG++ HTS, Jena Bioscience) using an Oryx8 robot (Douglas Instruments). Hanging-drop vapour diffusion in 24-well Greiner plates was used to test solutions comprising RSL or MK-RSL and 32 mM sclx8 in combination with 1–2 M sodium citrate at pH 4–6 or unbuffered. Crystallization drops were imaged using an Olympus SZX16 stereomicroscope and an Olympus DP25 digital camera.

2.3. X-ray data collection, processing and model building

Crystals were cryoprotected in the crystallization solution supplemented with 20–25%(v/v) glycerol and cryocooled in liquid nitrogen. Diffraction data were collected at 100 K on the PROXIMA-2A beamline at the SOLEIL synchrotron, Saint-Aubin, France using an EIGER X 9M detector. Data were processed using the autoPROC pipeline (Vonrhein et al., 2011[Vonrhein, C., Flensburg, C., Keller, P., Sharff, A., Smart, O., Paciorek, W., Womack, T. & Bricogne, G. (2011). Acta Cryst. D67, 293-302.]) with integration in XDS (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]) and scaling and merging in AIMLESS (Evans & Murshudov, 2013[Evans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204-1214.]) and POINTLESS (Evans, 2011[Evans, P. R. (2011). Acta Cryst. D67, 282-292.]). AIMLESS was used to cut the data to 1.18 Å resolution, with I/σ(I) = 1.80. Structures were solved via molecular replacement in Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) using the RSL monomer (PDB entry 2bt9) as a search model. The coordinates of sclx8 (PDB ID EVB) and D-fructose (PDB ID BDF) were added to each model in Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). Model building in Coot and refinement in phenix.refine (Adams et al., 2010[Adams, P. D., Afonine, P. V., Bunkóczi, G., Chen, V. B., Davis, I. W., Echols, N., Headd, J. J., Hung, L.-W., Kapral, G. J., Grosse-Kunstleve, R. W., McCoy, A. J., Moriarty, N. W., Oeffner, R., Read, R. J., Richardson, D. C., Richardson, J. S., Terwilliger, T. C. & Zwart, P. H. (2010). Acta Cryst. D66, 213-221.]) were performed iteratively until no further improvements in the Rfree or electron density could be made. The structures were validated in MolProbity (Williams et al., 2018[Williams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, D. C. (2018). Protein Sci. 27, 293-315.]) and deposited in the PDB with accession codes 8c9y and 8c9z. PDBePISA was used to determine protein–calixarene interface areas (Krissinel & Henrick, 2007[Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774-797.]). MAP_CHANNELS was used to calculate crystal pore diameters (Juers & Ruffin, 2014[Juers, D. H. & Ruffin, J. (2014). J. Appl. Cryst. 47, 2105-2108.]).

3. Results and discussion

3.1. Form IV crystallization conditions and structure determination

The JBScreen JCSG++ HTS screen applied to mixtures of MK-RSL and sclx8 gave rise to crystals (Fig. 2[link]a) in condition B11, unbuffered 1.6 M sodium citrate (nominally pH ∼8), at 32 mM calixarene. Previous (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]) and reiterated trials with RSL and sclx8 did not yield crystals in this condition. The pH of condition B11 in situ is unknown. In the case of MK-RSL, which is prepared in potassium phosphate buffer, it is likely that the crystallization condition is pH 6–7. In the case of RSL, which is prepared in water, the pH may be ∼7 or higher. The elevated pI of MK-RSL with respect to RSL further hinted that the protein net charge may be important for co-crystallization in this condition. Consequently, hanging-drop vapour-diffusion trials were prepared in 1–2 M sodium citrate buffered at pH 4–6. Rhombohedral crystals of dimensions of ∼150 µm appeared in 1–2 days at 1.0–1.2 M sodium citrate pH 6 or 5 (Fig. 2[link]). This crystal morphology, while similar to that obtained with MK-RSL, was distinct from those reported previously for RSL and sclx8 (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). Two morphologies, including rod-shaped crystals, grew in drops at pH 5. At pH 4 only the rods were obtained. Similarly, at >1.4 M sodium citrate pH 5 or 6 only the rods grew.

[Figure 2]
Figure 2
(a) MK-RSL–sclx8 co-crystals obtained in JBScreen JCSG++ HTS condition B11. (b, c, d) RSL–sclx8 co-crystallization trials in 1.0 M sodium citrate at pH 6, 5 or 4. Images are to scale and the scale bar is 100 µm in length.

Diffraction data were collected at the SOLEIL synchrotron. The rod crystals proved to be sclx8 only. The crystals with MK-RSL or RSL diffracted to beyond 1.2 Å resolution and essentially identical structures were solved in space group H32 (Table 2[link]) with electron density for sclx8 evident in the unbiased maps (Fig. 3[link]). In the MK-RSL–sclx8 structure the extended N-terminus is disordered, with no electron density for either Met0 or Lys1. Thus, while this mutant aided the discovery of crystal form IV, the extended N-terminus apparently does not bind calixarene.

Table 2
Crystallization conditions and X-ray data-collection, processing and refinement statistics for crystal form IV of RSL–sclx8 and MK-RSL–sclx8

Structure RSL–sclx8 MK-RSL–sclx8
Sequence SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN MKSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN
Crystallization
 [Sodium citrate] (M) 1.2 1.6
 pH 6.0 Unknown
Data collection
 Light source PROXIMA-2A, SOLEIL PROXIMA-2A, SOLEIL
 Wavelength (Å) 0.98011 0.98011
 Temperature (K) 100.0 100.0
 Space group H32 H32
a, b, c (Å) 76.114, 76.114, 113.659 75.933, 75.933, 113.851
α, β, γ (°) 90.0, 90.0, 120.0 90.0, 90.0, 120.0
 Resolution (Å) 57.02–1.18 (1.20–1.18) 56.94–1.18 (1.20–1.18)
 No. of reflections 722097 (17558) 633389 (15353)
 No. of unique reflections 41706 (1963) 41673 (2023)
 Multiplicity 17.3 (8.9) 15.2 (7.6)
 〈I/σ(I)〉 19.0 (1.8) 20.4 (1.8)
 Completeness (%) 99.8 (96.3) 100.0 (99.8)
Rmeas (%) 6.7 (138.3) 5.8 (131.4)
Rp.i.m. (%) 1.6 (44.8) 1.5 (46.4)
 CC1/2 1.000 (0.622) 1.000 (0.697)
 Solvent content (%) 51 51
Refinement
Rwork 0.165 0.163
Rfree 0.178 0.175
 R.m.s.d., bond lengths (Å) 0.005 0.005
 R.m.s.d., angles (°) 0.852 0.769
 No. of molecules in asymmetric unit
  Protein chains 1 1
  sclx8 2 2
  Waters 103 93
 Average B factor (Å2) 18.93 20.09
 Clashscore 3.59 2.96
 Ramachandran analysis, residues in
  Favoured regions (%) 98.86 98.88
  Allowed regions (%) 1.14 1.12
 PDB code 8c9z 8c9y
[Figure 3]
Figure 3
The RSL–sclx8 interfaces in crystal form IV showing the unbiased electron-density maps (2FoFc, calculated at 1.18 Å resolution prior to adding calixarenes to the model and contoured at 1σ). Two C2-symmetric interfaces are mediated by (a) one sclx8 molecule in the pleated loop and (b) two sclx8 molecules in a double-cone conformation. The sclx8 molecules are either wholly (a) or partly (b) located on a special position. Interface side chains are shown as sticks. For clarity, water molecules are omitted.

3.2. Calixarenes at special positions

Crystal form IV was solved in space group H32, with an asymmetric unit comprising one RSL monomer and two molecules of sclx8. Each calixarene is located at a special position on a crystallographic twofold axis. One sclx8 molecule occurs in the fully extended, pleated loop conformation, with all atoms on a special position and was modelled at 50% occupancy (Fig. 3[link]a). This sclx8 molecule is highly ordered with low average temperature factors (∼15 Å2) similar to those of the protein (∼18 Å2). The other sclx8 molecule, modelled at 70% occupancy, adopts a double-cone conformation (Fig. 3[link]b). This calixarene is less well defined (∼24 Å2), with three partly disordered phenol-sulfonate subunits, one of which is located on a special position.

We note two examples of protein–macrocycle co-crystal structures with features at special positions relevant to this study. A structure of concanavalin A in complex with tetrasulfonato-phenyl porphyrin (PDB entry 1jn2) solved in space group F222 includes half the porphyrin on crystallographic twofold axes (Goel et al., 2001[Goel, M., Jain, D., Kaur, K. J., Kenoth, R., Maiya, B. G., Swamy, M. J. & Salunke, D. M. (2001). J. Biol. Chem. 276, 39277-39281.]). A structure of Rhodobacter capsulatus bacterioferritin (PDB entry 1jgc) solved in space group I422 includes pseudo-C2-symmetric heme groups modelled at 50% occupancy on crystallographic twofold axes (Cobessi et al., 2002[Cobessi, D., Huang, L.-S., Ban, M., Pon, N. G., Daldal, F. & Berry, E. A. (2002). Acta Cryst. D58, 29-38.]).

3.3. Details of the calixarene binding sites

The pleated-loop sclx8 is nestled between two RSL trimers related by a 180° rotation (Fig. 3[link]a). Each protein buries ∼350 Å2 in the protein–sclx8–protein interface. Lys25, Asn42, Pro44 and Lys83 each contribute ≥45 Å2 to the interface area. The core of the interface is polar, involving Asn42, Glu43, the phenolic rim of sclx8 and several water molecules. Glu43 is likely to be protonated as it has an unusually high pKa value due to coplanar stacking of the carboxyl group with the indole of Trp74 (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). A central water molecule, at a special position, is within van der Waals distance of all eight phenol hydroxyls and is hydrogen-bonded to the carbonyl backbone of Asn42 and the side chain of Glu43. Lys25 and Lys83, the side-chain termini of which are disordered, occur on the binding-site periphery, making weak salt-bridge interactions with the sulfonic acids.

The double-cone sclx8, although partly disordered, also interacts with two RSL trimers related by a 180° rotation. This assembly resembles the sclx8-mediated crystallographic dimer of Penicillium antifungal protein (PDB entry 6haj; Alex et al., 2019[Alex, J. M., Rennie, M. L., Engilberge, S., Lehoczki, G., Dorottya, H., Fizil, Á., Batta, G. & Crowley, P. B. (2019). IUCrJ, 6, 238-247.]), as well as features in sclx8–cytochrome c complexes (for example PDB entry 6rsi; Engilberge et al., 2019[Engilberge, S., Rennie, M. L., Dumont, E. & Crowley, P. B. (2019). ACS Nano, 13, 10343-10350.]; Rennie et al., 2018[Rennie, M. L., Fox, G. C., Pérez, J. & Crowley, P. B. (2018). Angew. Chem. Int. Ed. 57, 13764-13769.]). To describe the calixarene binding mode at this site we must reconsider the previously reported RSL–sclx8 structures (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). The β-propeller fold of the RSL monomer comprises two four-stranded antiparallel β-sheets. Val13 and Lys34 are located in adjacent loops of one of the sheets. In crystal forms I, II and III, Val13 and Lys34 are extensively encapsulated by sclx8 cavities comprising either two or three phenol-sulfonate subunits. The calixarene conformation at this site in crystal form IV most resembles that in form I, with four contiguous subunits superposing with an r.m.s.d. of <1 Å. However, in crystal form IV the double-cone sclx8 spans two RSL molecules binding Val13 in one trimer and Lys34 in the other trimer. The larger interface buries ∼350 Å2 of the protein, with major contributions (≥45 Å2) from Val13 and Ser57, while the smaller interface buries ∼180 Å2 of the second protein with Lys34 and Tyr37 as the main contributors. In this novel arrangement, Val13 forms CH–π bonds with just one phenol-sulfonate, and Lys34, while partly disordered, is within the vicinity of four phenolic hydroxyls. Overall, a C2-symmetric assembly is mediated by two adjacent sclx8 molecules and the junction of the two calixarenes (on a special position) is disordered. The model is approximate at the special position, with the phenol-sulfonates of the two molecules being interchangeable (Fig. 3[link]b). A curious consequence of the C2 symmetry and the 70% occupancy at this site comprising two calixarene bridging ligands is that the framework is maintained even if only one calixarene is present. Apparently, the molecular-glue capacity of one calixarene is sufficient to maintain this junction.

3.4. A comparison of RSL–sclx8 co-crystal frameworks

Table 1[link] shows the breadth of conditions leading to RSL–sclx8 co-crystals, all of which were obtained at ∼1 mM protein. Crystallization of forms II and III requires ≤10 equivalents of calixarene to protein. In contrast, forms I and IV require >30 equivalents. Such high concentrations of the octa-anionic calixarene greatly increase the ionic strength (30 mM Na+sclx8, is approximately 1.1 M ionic strength) and are likely to combine with the effects of ∼1 M precipitant (ammonium sulfate or sodium citrate) to achieve supersaturation. High ionic strength and a broad pH range leads to the densely packed form I (P213). In contrast, the porous forms II (I23) and III (P3) grow at pH 4 or lower, where RSL is cationic. The former grows at ∼3 M ionic strength while the latter requires low salt. Previously, we noted that a pH trigger involving the protonation of one or two Asp side chains enables forms II and III (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). Interestingly, crystal form IV appears to be a hybrid structure requiring a relatively narrow pH range (5–6) and high ionic strength. A pH trigger may also be relevant here. Glu43 is centrally located on either side of the calixarene glue, forming hydrogen bonds to two of the phenolic hydroxyls and to the central water molecule (Fig. 3[link]a). The two symmetry-related Glu43 side-chain carboxylates are separated by <5.5 Å. With a pKa of ∼6 (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]) this side chain is likely to be protonated, thus facilitating assembly of the protein–calixarene–protein junction. This proposed mechanism differs from the previously described pH trigger, in which calixarene binding was coupled to protonation of Asp32 and/or Asp46 at a pH of ∼4. Attempts to obtain crystal form IV at pH 4 failed. It is plausible that sclx8 consumption within the rod crystals (Fig. 2[link]d) compromised the growth of RSL–sclx8 co-crystals. Considering the high ionic strength, form IV is relatively porous, contrasting with the densely packed form I that also grew at high ionic strength. Porous cytochrome c–sclx8 frameworks were obtained at high ionic strength, for example >1.8 M ammonium sulfate (Engilberge et al., 2019[Engilberge, S., Rennie, M. L., Dumont, E. & Crowley, P. B. (2019). ACS Nano, 13, 10343-10350.]; Rennie et al., 2018[Rennie, M. L., Fox, G. C., Pérez, J. & Crowley, P. B. (2018). Angew. Chem. Int. Ed. 57, 13764-13769.]).

Forms III and IV have similar (trigonal) packing, with each protein trimer connected to six other trimers via calixarene junctions. The RSL trimer is a toroid (Kostlánová et al., 2005[Kostlánová, N., Mitchell, E. P., Lortat-Jacob, H., Oscarson, S., Lahmann, M., Gilboa-Garber, N., Chambat, G., Wimmerová, M. & Imberty, A. (2005). J. Biol. Chem. 280, 27839-27849.]), like a tube cake, with a wide end (∼4.5 nm) and a narrow end (∼2.5 nm). Lys34 is located at the wide end, Lys25 at the narrow end and Lys83 is midway between the two. In form III (P3) the wide ends and narrow ends are bridged together by calixarenes. Each protein trimer shares six calixarenes with symmetry-related proteins in the crystal packing. In form IV (H32), two symmetry-related calixarenes (Figs. 3[link]b and 4[link]) mediate packing between the wide ends. Protein–calixarene–protein packing also occurs via the mid-regions of the toroids. Notwithstanding the reduced occupancy, each trimer effectively shares nine calixarenes with symmetry mates. Form I also involves nine shared calixarenes, albeit with several small (<90 Å2) interfaces. Form II (I23) has eight calixarene-coated trimers making up the cubic unit cell. In this packing, each RSL trimer shares 12 calixarenes (arranged as dimers) with symmetry mates. Thus, it appears that form IV is intermediate to forms II and III. Strikingly, form IV utilizes a new calixarene binding arrangement at the wide end of RSL, while the calixarene binding site at Lys25/Lys83 replicates a feature found in form II (Figs. 4[link] and 5[link]). Fig. 4[link] shows the asymmetric units and unit cells of forms II and IV. The calixarenes coloured green are similar in the two structures. The calixarenes coloured mauve, although in different conformations, bind to similar regions of the protein. In form II, the two calixarenes dimerize to mediate the cubic packing (Figs. 4[link] and 5[link]). In form IV, each calixarene acts as an independent molecular glue to mediate two distinct C2-symmetric interfaces. Apparently, the polymorph selection is controlled by the choice of precipitant (ammonium sulfate or sodium citrate), the ionic strength and the pH (Table 1[link]).

[Figure 4]
Figure 4
The asymmetric units and unit cells of RSL–sclx8 forms IV (H32) and II (I23). The unit cell is depicted with one RSL trimer in ribbon representation and the corresponding calixarenes in colour. The remaining components are in grey with proteins as transparent surfaces. The unit cells are drawn to scale and the approximate c dimension is indicated in form IV.
[Figure 5]
Figure 5
The RSL–sclx8 interfaces at Glu43 in crystal forms (a) IV (H32) and (b) II (I23). Glu43 and the flanking side chains Asn42, Pro44 and Trp74 are shown as sticks. For clarity, water molecules are omitted.

4. Conclusions

The commercially available sclx8 is a versatile mediator of protein crystallization (Alex et al., 2019[Alex, J. M., Rennie, M. L., Engilberge, S., Lehoczki, G., Dorottya, H., Fizil, Á., Batta, G. & Crowley, P. B. (2019). IUCrJ, 6, 238-247.]; Engilberge et al., 2019[Engilberge, S., Rennie, M. L., Dumont, E. & Crowley, P. B. (2019). ACS Nano, 13, 10343-10350.]; Rennie et al., 2018[Rennie, M. L., Fox, G. C., Pérez, J. & Crowley, P. B. (2018). Angew. Chem. Int. Ed. 57, 13764-13769.]). This flexible macrocyclic anion can bind to the same protein surface in different ways, leading to distinct assemblies. Using RSL and sclx8 building blocks, four crystalline frameworks with a range of porosities (36–66% solvent content) can be generated (Table 1[link]). Apparently, crystal engineering is relatively straightforward with selection via the choice/concentration of precipitant and the pH. Three of the co-crystal forms were discovered previously (Ramberg, Engilberge, Skorek et al., 2021[Ramberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896-1907.]). Two of these were hits in a commercial screen, while the third occurred in an NMR sample. Crystal form IV was not obtained in the original trials with RSL because the effect of pH on the sodium citrate condition was not studied. Testing the cation-enriched variant MK-RSL led to the discovery of form IV. Future protein–calixarene co-crystallization trials will include focused testing in sodium citrate at pH 4–6. Such simple crystallization conditions are attractive in the context of protein-based materials and industrial applications.

While the strict definition of a polymorph, an `identical chemical composition but different crystal structure', does not necessarily apply to protein crystals (Jones & Ulrich, 2010[Jones, M. J. & Ulrich, J. (2010). Chem. Eng. Technol. 33, 1571-1576.]; Ulrich & Pietzsch, 2015[Ulrich, J. & Pietzsch, M. (2015). Cryst. Res. Technol. 50, 560-565.]), it is reasonable to assert that the RSL–sclx8 co-crystals are polymorphs. Crystal form IV is another point on the RSL–sclx8 crystal-engineering landscape. Form IV appears to be a hybrid with properties (including crystallization conditions, calixarene binding sites and crystal packing) intermediate to the original forms. It remains to be seen whether yet other polymorphs will be discovered. Interestingly, three of the four RSL–sclx8 co-crystal forms are porous (solvent contents ranging from 51% to 66%) and are mediated exclusively by the calixarene (Fig. 4[link]). Such engineered frameworks hold promise for the design and development of new protein-based materials.

Acknowledgements

We thank the SOLEIL synchrotron for beam-time allocation and the staff at the PROXIMA-2A beamline for their assistance with data collection. We acknowledge S. Engilberge (Grenoble) for helpful discussions and the anonymous referees who contributed to improving the paper. The authors report no conflicts of interest. Open access funding provided by IReL.

Funding information

We thank the University of Galway, the Irish Research Council (grant GOIPG/2021/333 to NMM), the National University of Ireland (Travelling Studentship to KOR) and Science Foundation Ireland (grants 13/CDA/2168 and 12/RC/2275_P2) for funding.

References

First citationAdams, P. D., Afonine, P. V., Bunkóczi, G., Chen, V. B., Davis, I. W., Echols, N., Headd, J. J., Hung, L.-W., Kapral, G. J., Grosse-Kunstleve, R. W., McCoy, A. J., Moriarty, N. W., Oeffner, R., Read, R. J., Richardson, D. C., Richardson, J. S., Terwilliger, T. C. & Zwart, P. H. (2010). Acta Cryst. D66, 213–221.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationAlex, J. M., Rennie, M. L., Engilberge, S., Lehoczki, G., Dorottya, H., Fizil, Á., Batta, G. & Crowley, P. B. (2019). IUCrJ, 6, 238–247.  CrossRef CAS PubMed IUCr Journals Google Scholar
First citationAtwood, J. L., Barbour, L. J., Jerga, A. & Schottel, B. L. (2002). Science, 298, 1000–1002.  Web of Science CSD CrossRef PubMed CAS Google Scholar
First citationCobessi, D., Huang, L.-S., Ban, M., Pon, N. G., Daldal, F. & Berry, E. A. (2002). Acta Cryst. D58, 29–38.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationDesiraju, G. R. (2021). IUCrJ, 8, 148–149.  CrossRef CAS PubMed IUCr Journals Google Scholar
First citationEbrahim, A., Appleby, M. V., Axford, D., Beale, J., Moreno-Chicano, T., Sherrell, D. A., Strange, R. W., Hough, M. A. & Owen, R. L. (2019). Acta Cryst. D75, 151–159.  Web of Science CrossRef IUCr Journals Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEngilberge, S., Rennie, M. L., Dumont, E. & Crowley, P. B. (2019). ACS Nano, 13, 10343–10350.  CrossRef CAS PubMed Google Scholar
First citationEvans, P. R. (2011). Acta Cryst. D67, 282–292.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEvans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204–1214.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationGillespie, C. M., Asthagiri, D. & Lenhoff, A. M. (2014). Cryst. Growth Des. 14, 46–57.  Web of Science CrossRef CAS PubMed Google Scholar
First citationGoel, M., Jain, D., Kaur, K. J., Kenoth, R., Maiya, B. G., Swamy, M. J. & Salunke, D. M. (2001). J. Biol. Chem. 276, 39277–39281.  Web of Science CrossRef PubMed CAS Google Scholar
First citationJones, M. J. & Ulrich, J. (2010). Chem. Eng. Technol. 33, 1571–1576.  CrossRef CAS Google Scholar
First citationJuers, D. H. & Ruffin, J. (2014). J. Appl. Cryst. 47, 2105–2108.  Web of Science CrossRef IUCr Journals Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKostlánová, N., Mitchell, E. P., Lortat-Jacob, H., Oscarson, S., Lahmann, M., Gilboa-Garber, N., Chambat, G., Wimmerová, M. & Imberty, A. (2005). J. Biol. Chem. 280, 27839–27849.  Web of Science PubMed Google Scholar
First citationKravets, K., Kravets, M., Kędra, K. & Danylyuk, O. (2021). Supramol. Chem. 33, 666–676.  CSD CrossRef CAS Google Scholar
First citationKrissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774–797.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLanza, A., Margheritis, E., Mugnaioli, E., Cappello, V., Garau, G. & Gemmi, M. (2019). IUCrJ, 6, 178–188.  Web of Science CrossRef CAS PubMed IUCr Journals Google Scholar
First citationLeśniewska, B., Coleman, A. W., Perret, F. & Suwińska, K. (2019). Cryst. Growth Des. 19, 1695–1708.  Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMcGovern, R. E., McCarthy, A. A. & Crowley, P. B. (2014). Chem. Commun. 50, 10412–10415.  Web of Science CrossRef CAS Google Scholar
First citationMcGovern, R. E., Snarr, B. D., Lyons, J. A., McFarlane, J., Whiting, A. L., Paci, I., Hof, F. & Crowley, P. B. (2015). Chem. Sci. 6, 442–449.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMcPherson, A. & Cudney, B. (2006). J. Struct. Biol. 156, 387–406.  Web of Science CrossRef PubMed CAS Google Scholar
First citationMoulton, B. & Zaworotko, M. J. (2001). Chem. Rev. 101, 1629–1658.  Web of Science CrossRef PubMed CAS Google Scholar
First citationNguyen, T. K., Abe, S., Kasamatsu, M., Maity, B., Yamashita, K., Hirata, K., Kojima, M. & Ueno, T. (2021). ACS Appl. Nano Mater. 4, 1672–1681.  CrossRef CAS Google Scholar
First citationPasquale, S., Sattin, S., Escudero-Adán, E. C., Martínez-Belmonte, M. & de Mendoza, J. (2012). Nat. Commun. 3, 785.  Web of Science CSD CrossRef PubMed Google Scholar
First citationPlaza-Garrido, M., Salinas-Garcia, M. C. & Camara-Artigas, A. (2018). Acta Cryst. D74, 480–489.  Web of Science CrossRef IUCr Journals Google Scholar
First citationRamberg, K. O., Engilberge, S., Guagnini, F. & Crowley, P. B. (2021). Org. Biomol. Chem. 19, 837–844.  CrossRef CAS PubMed Google Scholar
First citationRamberg, K. O., Engilberge, S., Skorek, T. & Crowley, P. B. (2021). J. Am. Chem. Soc. 143, 1896–1907.  CrossRef CAS PubMed Google Scholar
First citationRennie, M. L., Fox, G. C., Pérez, J. & Crowley, P. B. (2018). Angew. Chem. Int. Ed. 57, 13764–13769.  Web of Science CrossRef CAS Google Scholar
First citationUlrich, J. & Pietzsch, M. (2015). Cryst. Res. Technol. 50, 560–565.  CrossRef CAS Google Scholar
First citationVan Driessche, A. E. S., Van Gerven, N., Bomans, P. H. H., Joosten, R. R. M., Friedrich, H., Gil-Carton, D., Sommerdijk, N. A. J. M. & Sleutel, M. (2018). Nature, 556, 89–94.  Web of Science CrossRef CAS PubMed Google Scholar
First citationVaney, M. C., Broutin, I., Retailleau, P., Douangamath, A., Lafont, S., Hamiaux, C., Prangé, T., Ducruix, A. & Riès-Kautt, M. (2001). Acta Cryst. D57, 929–940.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationVonrhein, C., Flensburg, C., Keller, P., Sharff, A., Smart, O., Paciorek, W., Womack, T. & Bricogne, G. (2011). Acta Cryst. D67, 293–302.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationVuolanto, A., Uotila, S., Leisola, M. & Visuri, K. (2003). J. Cryst. Growth, 257, 403–411.  Web of Science CrossRef CAS Google Scholar
First citationWilliams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, D. C. (2018). Protein Sci. 27, 293–315.  Web of Science CrossRef CAS PubMed Google Scholar
First citationZalar, M., Bye, J. & Curtis, R. (2023). J. Am. Chem. Soc. 145, 929–943.  CrossRef CAS PubMed Google Scholar
First citationZhu, J., Avakyan, N., Kakkis, A., Hoffnagle, A. M., Han, K., Li, Y., Zhang, Z., Choi, T. S., Na, Y., Yu, C. J. & Tezcan, F. A. (2021). Chem. Rev. 121, 13701–13796.  CrossRef CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983
Follow Acta Cryst. D
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds