crystallization communications
Crystallization and preliminary X-ray of the N-terminal domain of human coronavirus OC43 nucleocapsid protein
aDepartment of Life Sciences, National Chung Hsing University, Taichung 402, Taiwan, bNational Synchrotron Radiation Research Center, Hsinchu 300, Taiwan, cInstitute of Biological Chemistry, Academia Sinica, Taipei 115, Taiwan, dInstitute of Bioengineering, Tatung University, Taipei 104, Taiwan, eInstitute of Chemistry, Academia Sinica, Taipei 11529, Taiwan, and fInstitute of Genomics and Bioinformatics, National Chung Hsing University, Taichung 402, Taiwan
*Correspondence e-mail: [email protected]
The N-terminal domain of nucleocapsid protein from human coronavirus OC43 (HCoV-OC43 N-NTD) mostly contains positively charged residues and has been identified as being responsible for RNA binding during ribonucleocapsid formation in the coronavirus. In this study, the crystallization and preliminary crystallographic analysis of HCoV-OC43 N-NTD (amino acids 58–195) with a molecular weight of 20 kDa are reported. HCoV-OC43 N-NTD was crystallized at 293 K using PEG 1500 as a precipitant and a 99.9% complete native data set was collected to 1.7 Å resolution at 100 K with an overall Rmerge of 5.0%. The crystals belonged to the hexagonal P65, with unit-cell parameters a = 81.57, c = 42.87 Å. Solvent-content calculations suggest that there is likely to be one subunit of N-NTD in the asymmetric unit.
1. Introduction
Human coronavirus OC43 (HCoV-OC43) is responsible for approximately 20% of all colds (Kaye et al., 1971
; Lai & Cavanagh, 1997
). Although HCoV-OC43 infections are generally mild, more severe upper and lower respiratory-tract infections such as bronchiolitis and pneumonia have been characterized, especially in infants, elderly individuals and immunocompromised patients (El-Sahly et al., 2000
; Gagneur et al., 2002
; St-Jean et al., 2004
). According to serological cross-reactivity, HCoV-OC43 is a representative of the class II coronaviruses. The RNA genomes of coronaviruses comprise of several genes that encode several structural and nonstructural proteins and are arranged in the order 5′-pol (polymerase)–S (spike)–E (envelope)–M (matrix)–N (nucleocapsid)-3′ (Navas-Martin & Weiss, 2004
). The virion envelope surrounding the nucleocapsid contains the structural proteins S, M, E and N. Some of them contain a third glycoprotein, HE (haemagglutinin-esterase), which is present in most class II coronaviruses. The primary function of the HCoV N protein is to recognize a stretch of RNA that serves as a packaging signal and leads to the formation of the ribonucleoprotein (RNP) complex during assembly (Lai & Cavanagh, 1997
). RNP may be important in keeping the RNA in an ordered conformation suitable for replication and transcription of the viral genome (Lai, 2003
; Nelson et al., 2000
; Huang et al., 2004
; Navas-Martin & Weiss, 2004
). In addition, the N protein is also an important diagnostic marker and is the most immunodominant antigen in infected hosts (Chan et al., 2005
; Woo et al., 2004
).
The N protein of HCoV-OC43 has a molecular weight of 49.5 kDa and a pI of 10.0 and is a highly basic protein with a high hydrophilicity (Hogue & Brian, 1986
; Pohl-Koppe et al., 1995
). We have previously shown that the N-terminal domain of HCoV-OC43 (N-NTD) contains most of the positively charged residues that are responsible for RNA binding, while the C-terminal domain (N-CTD) mainly acts as an oligomerization module to form a capsid (Huang et al., 2009
; Saikatendu et al., 2007
; Jayaram et al., 2006
; Fan et al., 2005
). The central disordered region of the N protein has also been shown to contain an RNA-binding region (Chang et al., 2009
). In order to clarify the mechanism by which the N protein of HCoV-OC43 binds to nucleic acids, we have undertaken the determination of the crystal structure of the N-terminal domain of HCoV-OC43 (residues 58–195).
2. Experimental methods
2.1. Expression and purification of HCoV-OC43 N-NTD
The templates for the HCoV-OC43 N protein were kindly provided by the Institute of Biological Chemistry, Academia Sinica (Taipei, Taiwan). In order to generate a truncated form of the recombinant HCoV-OC43 N-NTD, the gene encoding the N protein was amplified by the (PCR) using Pfu polymerase with the forward primer 5′-CGCTATGAATTCAATGTTGTACCCTACTATTCTTGGTTC-3′ and the reverse primer 5′-ACAACGCTCGAGAGCAGACCTTCCTGAGCCTTCAATAT-3′. The PCR products were digested with EcoRI and XhoI and the resulting DNA fragments were cloned into pET28a (Novagen) using T4 ligase (NEB). The recombinant plasmid was transformed into Escherichia coli BL21-RIL using the heat-shock method. The cells were grown at 310 K in Luria–Bertani medium containing 50 mg l−1 kanamycin. Protein expression was induced at an OD600 of 0.6 by the addition of 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG) at 283 K for 24 h. The expressed N-NTD contains N-terminal (MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF) and C-terminal (LEHHHHHH) tags. After harvesting the bacteria by centrifugation (6000 rev min−1, 30 min, 277 K), the bacterial pellets were resuspended in sonication buffer (50 mM Tris-buffered solution pH 7.5, 150 mM NaCl and 15 mM imidazole) and lysed by sonication for 30 min (3 s pulse on and 6 s pulse off). Soluble proteins were obtained from the supernatant by centrifugation (13 000 rev min−1, 30 min, 277 K). N-NTD carrying His6 tags at the N-terminus and C-terminus was purified using an Ni–NTA column (Novagen) with an elution gradient from 15 to 250 mM imidazole in buffer solution (50 mM Tris-buffered solution pH 7.5 and 150 mM NaCl). Fractions containing N-NTD were pooled and collected at 250 mM imidazole and dialyzed against 50 mM Tris-buffered solution pH 7.5 containing 150 mM NaCl (Fig. 1
). The purified N-NTD was concentrated to 8 mg ml−1 in 50 mM Tris–HCl pH 7.5 containing 255 mM NaCl prior to crystallization.
| Figure 1 SDS–PAGE analysis of HCoV-OC43 N-NTD stained with Coomassie Brilliant Blue. Lane M, protein markers (kDa); lane 1, purified HCoV-OC43 N-NTD; lane 2, concentrated HCoV-OC43 N-NTD after dialysis. |
2.2. Crystallization
Initial crystallization experiments were set up using the Qiagen JCSG+ Suite and PACT Suite crystal screens (Newman, 2005
) using the sitting-drop vapour-diffusion method in accordance with our previously described protocol (Chou & Hou, 2008
). Each of the crystallization conditions (2 µl) from the screening kits was mixed with 1.5 µl purified protein solution (8 mg ml−1) and 0.5 µl 40% hexanediol at room temperature (∼298 K) and equilibrated against 400 µl solution in the well of a Cryschem plate. The conditions were refined over seven cycles and crystals were grown in solution containing 0.25 M succinic acid–phosphate–glycine (SPG) buffer pH 6.0, 25% PEG 1500 equilibrated at 293 K against 400 µl precipitation solution. The SPG buffer was prepared by mixing succinic acid (Sigma), sodium dihydrogen phosphate (Merck) and glycine (Merck) in a 2:7:7 molar ratio and was adjusted to pH 6.0 with sodium hydroxide (Newman, 2004
). The crystals appeared within two weeks and the largest crystal grew to dimensions of approximately 200 × 100 × 100 µm (Fig. 2
).
| Figure 2 Crystals of HCoV-OC43 N-NTD obtained with 25% PEG 1500 as a precipitant at pH 6.0 by the sitting-drop vapour-diffusion method. The approximate dimensions of the crystal are 200 × 100 × 100 µm. |
2.3. X-ray data collection and processing
Crystals were soaked in reservoir solution containing 30%(v/v) glycerol as a cryoprotectant prior to flash-cooling in a nitrogen-gas stream at 100 K. High-resolution X-ray data were collected using a synchrotron-radiation source. A preliminary diffraction image was obtained on NSRRC (National Synchrotron Radiation Research Center, Hsinchu, Taiwan) contract beamline BL12B2 at SPring-8 (Hyogo, Japan) using an ADSC Q210r detector. The complete data set was collected on beamline BL13B1 at NSRRC using an ADSC Q315r detector. The crystal-to-detector distance was 150 mm. The oscillation width and exposure time for each frame were 1° and 10 s, respectively. Crystallographic data integration and reduction were performed using the HKL-2000 program package (Otwinowski & Minor, 1997
). The crystallographic statistics of data collection for N-NTD are listed in Table 1
.
![]() . | ||||||||||||||||||||||||||
3. Results and discussion
The HCoV-OC43 N-NTD crystal chosen for this study was shown to diffract X-rays to 1.7 Å resolution (Fig. 3
) and belonged to space group P65, with unit-cell parameters a = 81.57, c = 42.87 Å. The Matthews coefficient of 2.06 Å3 Da−1 calculated using MATTHEWS_COEF (Collaborative Computational Project, Number 4, 1994
; Matthews, 1968
) suggested there was likely to be one molecule in the asymmetric unit, with a solvent content of 40.26%. A homology search for the HCoV-OC43 N-NTD structure was performed using the BLAST server (Altschul et al., 1997
; https://blast.ncbi.nlm.nih.gov/Blast.cgi ) when the synchrotron data were collected in December 2008. The sequence-alignment search indicated that HCoV-OC43 N-NTD shares 30–40% sequence identity with other N-NTDs of coronaviruses (Fig. 4
) and the N-terminal domain from SARS coronavirus (PDB code 2ofz ; Saikatendu et al., 2007
) was chosen as an initial search model owing to the low E value of 1 × 10−23. The first molecular-replacement trial was performed using the automated interface PERON at the Protein Tectonics Platform (PTP), RIKEN SPring-8 Center, Japan (Sugahara et al., 2008
). The best result was obtained using the MOLREP program (Vagin & Teplyakov, 2010
). A single and unambiguous solution for the rotation and translation function was obtained with reflections in the resolution range 30–3.0 Å, and yielded a final correlation coefficient of 0.79 and an R factor of 0.44. The core of the model consists of a tightly packed β-sheet of five antiparallel strands surrounded by large loops. Structural refinement of the HCoV-OC43 N-NTD is currently in progress.
| Figure 3 Typical X-ray diffraction pattern of HCoV-OC43 N-NTD. The arrow shows the data at the resolution limit (1.7 Å). |
| Figure 4 Multiple sequence alignment of CoV N-NTDs; T-Coffee (Notredame et al., 2000 ) was used to define conserved residues. The numbering above the sequence is for the amino-acid sequence from OC43. Conserved residues are shaded. Fully conserved residues are shaded red. Residues that were partially conserved at levels of 75% and 50% are shaded orange and yellow, respectively. The amino-acid sequences of OC43 (HCoV-OC43; NP_937954), SARS (SARS-CoV; ABI96968), 229E (HCoV-229E; AAG48597) and IBV (infectious bronchitis virus; AAB24054) N-NTD were obtained from GenBank. |
Footnotes
‡These authors contributed equally to this paper.
Acknowledgements
This work was supported by NCS 97-2311-B-005-003-MY3. We thank the beamline staff at beamline BL13B1 at the National Synchrotron Radiation Research Center (NSRRC; Hsinchu, Taiwan) and at the NSRRC contract beamline BL12B2 at SPring-8 (Hyogo, Japan) for assistance. We are also grateful to have the convenient computing environment provided by the Protein Tectonics Platform (PTP), which is a collaborative structural biology facility between NSRRC and RIKEN SPring-8 Center (Hyogo, Japan).
References
Altschul, S. F., Madden, T. L., Schäffer, A. A., Zhang, J., Zhang, Z., Miller, W. & Lipman, D. J. (1997). Nucleic Acids Res. 25, 3389–3402. CrossRef CAS PubMed Web of Science Google Scholar
Chan, K. H., Cheng, V. C., Woo, P. C., Lau, S. K., Poon, L. L., Guan, Y., Seto, W. H., Yuen, K. Y. & Peiris, J. S. (2005). Clin. Diagn. Lab. Immunol. 12, 1317–1321. Web of Science PubMed CAS Google Scholar
Chang, C.-K., Hsu, Y.-L., Chang, Y.-H., Chao, F.-A., Wu, M.-C., Huang, Y.-S., Hu, C.-K. & Huang, T. H. (2009). J. Virol. 83, 2255–2264. Web of Science CrossRef PubMed CAS Google Scholar
Chou, C.-C. & Hou, M.-H. (2008). Acta Cryst. F64, 1118–1120. Web of Science CrossRef IUCr Journals Google Scholar
Collaborative Computational Project, Number 4 (1994). Acta Cryst. D50, 760–763. CrossRef IUCr Journals Google Scholar
El-Sahly, H. M., Atmar, R. L., Glezen, W. P. & Greenberg, S. B. (2000). Clin. Infect. Dis. 31, 96–100. Web of Science CrossRef PubMed CAS Google Scholar
Fan, H., Ooi, A., Tan, Y. W., Wang, S., Fang, S., Liu, D. X. & Lescar, J. (2005). Structure, 13, 1859–1868. Web of Science CrossRef PubMed CAS Google Scholar
Gagneur, A., Sizun, J., Vallet, S., Legr, M. C., Picard, B. & Talbot, P. J. (2002). J. Hosp. Infect. 51, 59–64. Web of Science CrossRef PubMed CAS Google Scholar
Hogue, B. G. & Brian, D. A. (1986). Virus Res. 5, 131–144. CrossRef CAS PubMed Web of Science Google Scholar
Huang, C.-Y., Hsu, Y.-L., Chiang, W.-L. & Hou, M.-H. (2009). Protein Sci. 18, 2209–2218. Web of Science CrossRef PubMed CAS Google Scholar
Huang, Q., Yu, L., Petros, A. M., Gunasekera, A., Liu, Z., Xu, N., Hajduk, P., Mack, J., Fesik, S. W. & Olejniczak, E. T. (2004). Biochemistry, 43, 6059–6063. Web of Science CrossRef PubMed CAS Google Scholar
Jayaram, H., Fan, H., Bowman, B. R., Ooi, A., Jayaram, J., Collisson, E. W., Lescar, J. & Prasad, B. V. (2006). J. Virol. 80, 6612–6620. Web of Science CrossRef PubMed CAS Google Scholar
Kaye, H. S., Marsh, H. B. & Dowdle, W. R. (1971). Am. J. Epidemiol. 94, 43–49. CAS PubMed Web of Science Google Scholar
Lai, M. M. (2003). J. Biomed. Sci. 10, 664–675. CrossRef PubMed CAS Google Scholar
Lai, M. M. & Cavanagh, D. (1997). Adv. Virus Res. 48, 1–100. Web of Science CrossRef CAS PubMed Google Scholar
Matthews, B. W. (1968). J. Mol. Biol. 33, 491–497. CrossRef CAS PubMed Web of Science Google Scholar
Navas-Martin, S. R. & Weiss, S. (2004). J. Neurovirol. 10, 75–85. Web of Science CrossRef PubMed CAS Google Scholar
Nelson, G. W., Stohlman, S. A. & Tahara, S. M. (2000). J. Gen. Virol. 81, 181–188. Web of Science PubMed CAS Google Scholar
Newman, J. (2004). Acta Cryst. D60, 610–612. Web of Science CrossRef CAS IUCr Journals Google Scholar
Newman, J. (2005). Acta Cryst. D61, 490–493. Web of Science CrossRef CAS IUCr Journals Google Scholar
Notredame, C., Higgins, D. G. & Heringa, J. (2000). J. Mol. Biol. 302, 205–217. Web of Science CrossRef PubMed CAS Google Scholar
Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326. CrossRef CAS Web of Science Google Scholar
Pohl-Koppe, A., Raabe, T., Siddell, S. G. & ter Meulen, V. (1995). J. Virol. Methods, 55, 175–183. CrossRef CAS PubMed Web of Science Google Scholar
Saikatendu, K. S., Joseph, J. S., Subramanian, V., Neuman, B. W., Buchmeier, M. J., Stevens, R. C. & Kuhn, P. (2007). J. Virol. 81, 3913–3921. Web of Science CrossRef PubMed CAS Google Scholar
St-Jean, J. R., Jacomy, H., Desforges, M., Vabret, A., Freymuth, F. & Talbot, P. J. (2004). J. Virol. 78, 8824–8834. Web of Science CrossRef PubMed CAS Google Scholar
Sugahara, M. et al. (2008). J. Struct. Funct. Genomics, 9, 21–28. CrossRef PubMed CAS Google Scholar
Vagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22–25. Web of Science CrossRef CAS IUCr Journals Google Scholar
Woo, P. C., Lau, S. K., Wong, B. H., Chan, K.-H., Hui, W.-T., Kwan, G. S., Peiris, J. S., Couch, R. B. & Yuen, K.-Y. (2004). J. Clin. Microbiol. 42, 5885–5888. Web of Science CrossRef PubMed CAS Google Scholar
© International Union of Crystallography. Prior permission is not required to reproduce short quotations, tables and figures from this article, provided the original authors and source are cited. For more information, click here.


journal menu
![[\textstyle \sum_{hkl}\sum_{i}|I_{i}(hkl)- \langle I(hkl)\rangle|/] Mathematical equation](teximages/nj5060fi1.gif)
.



