structural communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Volume 68| Part 6| June 2012| Pages 610-615

A model for 3-methyladenine recognition by 3-methyladenine DNA glycosylase I (TAG) from Staphylococcus aureus

aThe BSRC, University of St Andrews, North Haugh, St Andrews KY16 9ST, Scotland
*Correspondence e-mail: naismith@st-and.ac.uk

(Received 29 March 2012; accepted 15 April 2012; online 22 May 2012)

The removal of chemically damaged DNA bases such as 3-methyladenine (3-­MeA) is an essential process in all living organisms and is catalyzed by the enzyme 3-MeA DNA glycosylase I. A key question is how the enzyme selectively recognizes the alkylated 3-MeA over the much more abundant adenine. The crystal structures of native and Y16F-mutant 3-MeA DNA glycosylase I from Staphylococcus aureus in complex with 3-MeA are reported to 1.8 and 2.2 Å resolution, respectively. Isothermal titration calorimetry shows that protonation of 3-MeA decreases its binding affinity, confirming previous fluorescence studies that show that charge–charge recognition is not critical for the selection of 3-MeA over adenine. It is hypothesized that the hydrogen-bonding pattern of Glu38 and Tyr16 of 3-MeA DNA glycosylase I with a particular tautomer unique to 3-MeA contributes to recognition and selection.

1. Introduction

Bacterial 3-methyladenine DNA glycosylase I (TAG; Forsyth et al., 2002[Forsyth, R. A. et al. (2002). Mol. Microbiol. 43, 1387-1400.]; Ji et al., 2001[Ji, Y., Zhang, B., Van Horn, S. F., Warren, P., Woodnutt, G., Burnham, M. K. & Rosenberg, M. (2001). Science, 293, 2266-2269.]) is ubiquitous in eubacteria (Supplementary Fig. S11; Drohat et al., 2002[Drohat, A. C., Kwon, K., Krosky, D. J. & Stivers, J. T. (2002). Nature Struct. Biol. 9, 659-664.]) but shows no sequence or structural similarity to mammalian 3-methyladenine DNA glycosylase (AAG; Lau et al., 2000[Lau, A. Y., Wyatt, M. D., Glassner, B. J., Samson, L. D. & Ellenberger, T. (2000). Proc. Natl Acad. Sci. USA, 97, 13573-13578.]). TAG belongs to the alkylpurine DNA glycosylase superfamily and hydrolyzes the N9–C1′ glycosylic bond between a 3-methyladenosine (3-MeA) nucleobase lesion and the deoxyribose ring (Ria­zuddin & Lindahl, 1978[Riazuddin, S. & Lindahl, T. (1978). Biochemistry, 17, 2110-2118.]; Bjelland et al., 1993[Bjelland, S., Bjørås, M. & Seeberg, E. (1993). Nucleic Acids Res. 21, 2045-2049.]; Fig. 1[link]a). 3-Methylation of adenine does not influence base pairing (Sedgwick et al., 2007[Sedgwick, B., Bates, P. A., Paik, J., Jacobs, S. C. & Lindahl, T. (2007). DNA Repair, 6, 429-442.]); rather, the methyl group blocks replication by interfering with the interactions of DNA polymerase (Sedgwick et al., 2007[Sedgwick, B., Bates, P. A., Paik, J., Jacobs, S. C. & Lindahl, T. (2007). DNA Repair, 6, 429-442.]; Engelward et al., 1996[Engelward, B. P., Dreslin, A., Christensen, J., Huszar, D., Kurahara, C. & Samson, L. (1996). EMBO J. 15, 945-952.]). Like the 8-oxoguanylate DNA glycosylases MutM and hOGG1 (Banerjee et al., 2005[Banerjee, A., Yang, W., Karplus, M. & Verdine, G. L. (2005). Nature (London), 434, 612-618.], 2006[Banerjee, A., Santos, W. L. & Verdine, G. L. (2006). Science, 311, 1153-1157.]; Banerjee & Verdine, 2006[Banerjee, A. & Verdine, G. L. (2006). Proc. Natl Acad. Sci. USA, 103, 15020-15025.]; Blainey et al., 2006[Blainey, P. C., van Oijen, A. M., Banerjee, A., Verdine, G. L. & Xie, X. S. (2006). Proc. Natl Acad. Sci. USA, 103, 5752-5757.]), TAG is thought to slide along the duplex until it encounters a lesion. TAG binds flipped-out 3-MeA and then cleaves the damaged base from the ribose. TAG from Staphylococcus aureus shares around 40% amino-acid sequence identity with the structurally characterized TAG enzymes from Salmonella typhi (Metz et al., 2007[Metz, A. H., Hollis, T. & Eichman, B. F. (2007). EMBO J. 26, 2411-2420.]) and Escherichia coli (Drohat et al., 2002[Drohat, A. C., Kwon, K., Krosky, D. J. & Stivers, J. T. (2002). Nature Struct. Biol. 9, 659-664.]). The crystal structure of the S. typhi enzyme complexed with 3-MeA and abasic DNA (Metz et al., 2007[Metz, A. H., Hollis, T. & Eichman, B. F. (2007). EMBO J. 26, 2411-2420.]) and an NMR structure of the E. coli enzyme complexed with 3-MeA (Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]) have been reported. Two absolutely conserved residues, Tyr16 and Glu38, were identified to form hydrogen bonds with 3-MeA and Trp46 stacks with 3-MeA (Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]; Metz et al., 2007[Metz, A. H., Hollis, T. & Eichman, B. F. (2007). EMBO J. 26, 2411-2420.]). The methyl group does not appear to make extensive contacts. The crystal structure of the apo S. aureus enzyme has been reported (Oke et al., 2010[Oke, M. et al. (2010). J. Struct. Funct. Genomics, 11, 167-180.]). We wished to probe the basis of the discrimination between adenine and 3-MeA in the S. aureus enzyme.

[Figure 1]
Figure 1
(a) The reaction catalyzed by TAG. (b) TAG is mainly α-helical; a structural zinc ion (grey sphere) is a found in all homologues of the enzyme. 3-MeA is shown in stick representation, with C atoms coloured yellow, N atoms coloured blue and O atoms coloured red. (c) Difference FoFc electron density contoured at 3σ for 3-­MeA in the active site of TAG. (d) Difference FoFc electron density contoured at 3σ for 3-MeA in the active site of Y16F-mutant TAG; C atoms are coloured pink. 3-MeA binds in a different orientation in the Y16F mutant.

2. Materials and methods

2.1. Protein production

Native and mutant protein were purified as described by Oke et al. (2010[Oke, M. et al. (2010). J. Struct. Funct. Genomics, 11, 167-180.]). Y16F and E38Q mutations were introduced using QuikChange (Stratagene); primers are listed in Table 1[link].

Table 1
Macromolecule-production information

The following primers were used to create the mutations: Y16F, 5′-GTACTAAAGATCCAGTCTACTTAAACTTTCATGATCATGTATGGG-3′ and 5′-CCCATACATGATCATGAAAGTTTAAGTAGACTGGATCTTTAGTAC-3′; E38Q, 5′-GCAAGGCATTGTTTAAACTTTTAGCATTACAGTCACAACATGCTGGG-3′ and 5′-CCCAGCATGTTGTGACTGTAATGCTAAAAGTTTAAACAATGCCTTGC-3′. Mutation sites are shown in bold.

Source organism S. aureus strain MSSA476
Expression vector pHis-TEV
Expression host E. coli
Complete amino-acid sequence of the construct produced GAMNECAFGTKDPVYLNYHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEAYEEAFYDFEPEKVAQMTAQDIDR LMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLKDCPSKPKHN

Fluorescence binding measurements were performed as described by Cao et al. (2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]) and Drohat et al. (2002[Drohat, A. C., Kwon, K., Krosky, D. J. & Stivers, J. T. (2002). Nature Struct. Biol. 9, 659-664.]). 2 µM TAG was titrated with 10–650 µM 3-MeA or adenine in 20 mM phosphate buffer pH 7.8 and 5.8; Figs. 2[link]a and 2[link]b). Isothermal titration calorimetry (ITC) experiments were carried out using a VP-ITC device (MicroCal) in the same buffer. 5 mM 3-MeA or 1.5 mM adenine solution was injected at 298 K into a sample cell containing ∼1.4 ml protein solution at 30–40 µM. Each titration consisted of a first 1 µl injection followed by up to 25 subsequent 10 µl injections or 48 subsequent 5 µl injections of the ligand as indicated. Calorimetric data were analyzed using the MicroCal ORIGIN software, fixing the stoichiometry as N = 1 (Figs. 2[link]c and 2[link]d; Supplementary Table S11).

[Figure 2]
Figure 2
(a) Measurement of the binding of 3-MeA to S. aureus TAG using intrinsic fluorescence quenching at pH 5.8 (Kd = 165 µM) and pH 7.8 (Kd = 78 µM); the results are similar to those previously reported for the E. coli enzyme (Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]). (b) Fluorescence quenching of 3-MeA with E38Q-mutant S. aureus TAG at pH 5.8 and 7.8. The small reduction in the binding constant was inconsistent with structural and previous functional data (Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]). This indicated that the fluorescence was unreliable for the S. aureus enzyme. (c) ITC measurement of the binding of 3-MeA to S. aureus TAG at pH 7.8 (Kd = 220 µM) and pH 5.8 (Kd = 470 µM). Adenosine does not bind. (d) ITC measurement of the binding of 3-MeA to Y16F-mutant (Kd = 1.2 mM; left) and E38Q-mutant (no binding; right) S. aureus TAG at pH 7.8. 1 cal = 4.186 kJ.

2.2. Crystallization

Sitting-drop vapour-diffusion crystallization trials (1 µl protein solution plus 1 µl precipitant solution) were set up using a Cartesian Honeybee nanodrop crystallization robot which was integrated in a Hamilton-Thermo Rhombix system. The 3-MeA complexes of native and Y16F TAG were obtained by incubating TAG with 10 mM 3-­MeA for 6 h before crystallization at 277 K. The complex crystals grew using a precipitant solution consisting of 0.1 M Tris–HCl pH 8.5, 1.8 M ammonium sulfate, 0.2 M Li2SO4 at 293 K as thin plates and grew to full size (0.2 × 0.2 × < 0.05 mm) in two to three weeks. Cryoprotectant solution was made by supplementing the crystallization precipitant solution with 20% glycerol. Crystals were mounted in Hampton Research cryoloops and rapidly cooled to 100 K prior to data collection.

2.3. Data collection and processing

Data for the native TAG–3-MeA complex were collected from a single crystal using 0.2° oscillations at a wavelength of 0.933 Å (ESRF beamline ID14-2) and were reduced using XDS (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]). Data were collected from a single crystal of the Y16F TAG–3-MeA complex using an in-house Rigaku MicroMax-007 HF rotating-anode generator and Saturn 944 CCD detector. Data were reduced using HKL-2000 (Otwinowski & Minor, 1997[Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307-326.]) and POINTLESS (Evans, 2006[Evans, P. (2006). Acta Cryst. D62, 72-82.]; Potterton et al., 2003[Potterton, E., Briggs, P., Turkenburg, M. & Dodson, E. (2003). Acta Cryst. D59, 1131-1137.]; Winn et al., 2011[Winn, M. D. et al. (2011). Acta Cryst. D67, 235-242.]). Full details are given in Table 2[link]. The E38Q mutant was also crystallized, but as no 3-MeA was located in the active site the structure is not described here; however, the structure has been deposited (PDB entry 4ai4 ).

Table 2
Data-collection and processing statistics

Values in parentheses are for the last shell.

Protein Native, 3-MeA complex Y16F, 3-MeA complex
Diffraction source ESRF beamline ID14-2 Rotating anode
Wavelength (Å) 0.933 1.54
Temperature (K) 100 100
Detector ADSC Quantum 4 CCD Saturn CCD
Crystal-to-detector distance (mm) 203 55
Rotation range per image (°) 0.2 0.5
Total rotation range (°) 108 180
Exposure time per image (s) 5 5
Space group C2 C2
Unit-cell parameters
a, b, c (Å) 73.00, 78.59, 179.81 72.3, 78.8, 179.3
α, β, γ (°) 90, 90.56, 90 90, 90.5, 90
Mosaicity (°) 0.3 0.56
Resolution range (Å) 29.60–1.80 (1.85–1.80) 50–2.2 (2.28–2.20)
Total No. of reflections 341926 118143
No. of unique reflections 92544 (5876) 47714 (3209)
Completeness (%) 98.4 (91.6) 95.5 (89.1)
Redundancy 3.7 (3.1) 2.6 (2.3)
I/σ(I)〉 17.50 (3.9) 28.2 (10.9)
Rr.i.m. 0.059 (0.292) 0.04 (0.11)
Overall B factor from Wilson plot (Å2) 18 24.2
†Estimated Rr.i.m. = Rmerge[N/(N − 1)]1/2, where N is the data multiplicity.

2.4. Structure solution and refinement

The structures were solved with Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) using the native apo structure (Oke et al., 2010[Oke, M. et al. (2010). J. Struct. Funct. Genomics, 11, 167-180.]; PDB entry 2jg6 ) as a search model. As the complex crystals grew in a different space group to the native crystals, a new free set of reflections was assigned for refinement. All structures were refined with REFMAC v.5.6.0117 (Murshudov et al., 2011[Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355-367.]); manual intervention employed Coot (Emsley & Cowtan, 2004[Emsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126-2132.]). 3-MeA was added to the models when the FoFc density was clear (Figs. 1[link]c and 1[link]d). MolProbity (Chen et al., 2010[Chen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12-21.]) was used for structure validation and Ramachandran analysis. TLS parameters were used in refinement. TLS groups were assigned using the TLSMD server (Painter & Merritt, 2006[Painter, J. & Merritt, E. A. (2006). J. Appl. Cryst. 39, 109-111.]). Details of the refinement are given in Table 3[link].

Table 3
Structure refinement

Values in parentheses are for the last shell.

Protein Native, 3-MeA complex (PDB entry 4aia ) Y16F, 3-MeA complex (PDB entry 4ai5 )
Resolution range (Å) 28.19–1.80 (1.847–1.800) 179.29–2.22 (2.276–2.218)
Completeness (%) 98.2 95.3
σ cutoff 0 0
No. of reflections, working set 87884 (5568) 45350 (3043)
No. of reflections, test set 4654 (308) 2364 (166)
Final Rcryst 0.179 (0.233) 0.183 (0.193)
Final Rfree 0.218 (0.289) 0.216 (0.244)
No. of non-H atoms
 Protein 7598 7602
 Ion 25 25
 Ligand 55 55
 Water 927 486
 Total 8605 8168
R.m.s. deviations
 Bonds (Å) 0.009 0.015
 Angles (°) 1.189 1.550
Average B factors (Å2)
 Protein 22.2 21.7
 Ion 29.9 29.2
 Ligand 15.4 17.3
 Water 25.5 22.1
Ramachandran plot
 Favoured regions (%) 98.5 98.4
 Additionally allowed (%) 1.4 1.5

3. Results and discussion

The structure of the S. aureus TAG–3-MeA complex was determined to 1.8 Å resolution and that of the Y16F TAG–3-MeA complex to 2.22 Å resolution. The structure of the native 3-MeA complex is very similar to the crystal structure of the S. typhi TAG–3-MeA–abasic DNA complex (Metz et al., 2007[Metz, A. H., Hollis, T. & Eichman, B. F. (2007). EMBO J. 26, 2411-2420.]) and the NMR structure of the E. coli TAG–3-MeA complex (Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]). Relative to apo TAG (Oke et al., 2010[Oke, M. et al. (2010). J. Struct. Funct. Genomics, 11, 167-180.]), Glu38 has rotated to make 2.7 Å contacts with the exocyclic N atom and N7 of 3-MeA. Tyr16 moves to make a 2.8 Å contact with the exocyclic N atom of 3-MeA (Fig. 3[link]a). Trp46 stacks with the bound purine ring of 3-MeA, while Phe6, Tyr13 and Tyr21 make edge-on contacts. His41 rotates 80° to create space for 3-­MeA to bind. The Y16F-mutant complex revealed that 3-MeA adopts a different orientation, although it preserves a bidentate hydrogen bond to Glu38 and a stacking interaction with Trp46 (Fig. 3[link]b). This conformation is unlikely to be physiologically relevant, as it would require a very different orientation of the DNA to that observed in the S. typhi complex (Metz et al., 2007[Metz, A. H., Hollis, T. & Eichman, B. F. (2007). EMBO J. 26, 2411-2420.]). Using a fluorescence assay, we measured 3-MeA binding (Fig. 2[link]a), obtaining a similar result at pH 7.8 (Kd = 78 µM) to that for the E. coli enzyme at pH 7.5 (Kd = 42 µM; Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]). However, the assay is flawed for the S. aureus enzyme as the E38Q mutant gave the same result as for the native protein (Fig. 2[link]b), which is physically unreasonable. ITC (Figs. 2[link]c and 2[link]d) showed clear differences between the native and mutant S. aureus enzymes (Y16F, Kd = 1.2 mM; E38Q, no binding) and gave Kd values of 220 µM at pH 7.8 and 471 µM at pH 5.8 for the native enzyme. We did not detect adenine binding.

[Figure 3]
Figure 3
(a) Structure of the 3-MeA–TAG complex (C atoms, yellow; N atoms, blue; O atoms, red) showing the key interactions. The apo structure is shown with C atoms in white. (b) Structure of the 3-MeA–Y16F TAG complex (C atoms shown in pink); the 3-MeA ring adopts a different orientation in the mutant. The 3-MeA in the native protein is also shown. (c) The most common tautomer of 3-MeA could be recognized by a specific hydrogen-bond arrangement of Tyr16 and Glu38. The predominant tautomer of protonated 3-MeA and adenosine would not match this hydrogen-bonding arrangement. (d) DNA damage leads to formation of the positively charged tautomer that is optimal for recognition by TAG; in addition, the highly electron-deficient ring would interact favourably with the TAG active site.

3-Methyldeoxyadenosine is positively charged in DNA, whilst deoxyadenosine is neutral; simple charge–charge recognition was therefore the original explanation for the specificity of TAG (Labahn et al., 1996[Labahn, J., Schärer, O. D., Long, A., Ezaz-Nikpay, K., Verdine, G. L. & Ellenberger, T. E. (1996). Cell, 86, 321-329.]; Lau et al., 2000[Lau, A. Y., Wyatt, M. D., Glassner, B. J., Samson, L. D. & Ellenberger, T. (2000). Proc. Natl Acad. Sci. USA, 97, 13573-13578.]; Hollis et al., 2000[Hollis, T., Ichikawa, Y. & Ellenberger, T. (2000). EMBO J. 19, 758-766.]). However, it has been shown that E. coli TAG binds 3-MeA but not adenine and binds protonated 3-MeA (pH 5.7) more weakly than neutral 3-MeA (pH 7.5) (Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]; Drohat et al., 2002[Drohat, A. C., Kwon, K., Krosky, D. J. & Stivers, J. T. (2002). Nature Struct. Biol. 9, 659-664.]), establishing that charge–charge recognition is not the sole explanation (Cao et al., 2003[Cao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012-48020.]). We suggest that a particular hydrogen-bond pattern contributes to the selection of a specific but favoured (Sharma & Lee, 2002[Sharma, S. & Lee, J. K. (2002). J. Org. Chem. 67, 8360-8365.]) neutral tautomer of 3-MeA (Fig. 3[link]c) that is not available to adenosine (Fig. 3[link]c) and that is disfavoured for protonated 3-MeA (Fig. 3[link]c). Our hypothesis implies that there is an energetic penalty in reorganizing the hydrogen-bond network around Tyr16 to avoid a van der Waals clash (Fig. 3[link]c). In DNA, 3-methyldeoxyadenosine can adopt a tautomer that has the same hydrogen arrangement as neutral 3-­MeA and has positive charge (Fig. 3[link]d), which is favoured at the active site (Metz et al., 2007[Metz, A. H., Hollis, T. & Eichman, B. F. (2007). EMBO J. 26, 2411-2420.]). A clash of H atoms was observed between the amide of His136 and the amino group of adenine in human AAG and is used to preferentially select the damaged purine base (O'Brien & Ellenberger, 2004[O'Brien, P. J. & Ellenberger, T. (2004). J. Biol. Chem. 279, 9750-9757.]). Higher resolution data or neutron diffraction are required to further test the hypothesis for the TAG enzyme.

Supporting information


Footnotes

1Supplementary material has been deposited in the IUCr electronic archive (Reference: GX5204 ).

Acknowledgements

The work was funded by the BBSRC SPoRT initiative (BB_BBS/B/14426).

References

First citationBanerjee, A., Santos, W. L. & Verdine, G. L. (2006). Science, 311, 1153–1157.  Web of Science CrossRef PubMed CAS Google Scholar
First citationBanerjee, A. & Verdine, G. L. (2006). Proc. Natl Acad. Sci. USA, 103, 15020–15025.  Web of Science CrossRef PubMed CAS Google Scholar
First citationBanerjee, A., Yang, W., Karplus, M. & Verdine, G. L. (2005). Nature (London), 434, 612–618.  Web of Science CrossRef PubMed CAS Google Scholar
First citationBjelland, S., Bjørås, M. & Seeberg, E. (1993). Nucleic Acids Res. 21, 2045–2049.  CrossRef CAS PubMed Web of Science Google Scholar
First citationBlainey, P. C., van Oijen, A. M., Banerjee, A., Verdine, G. L. & Xie, X. S. (2006). Proc. Natl Acad. Sci. USA, 103, 5752–5757.  Web of Science CrossRef PubMed CAS Google Scholar
First citationCao, C., Kwon, K., Jiang, Y. L., Drohat, A. C. & Stivers, J. T. (2003). J. Biol. Chem. 278, 48012–48020.  Web of Science CrossRef PubMed CAS Google Scholar
First citationChen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12–21.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationDrohat, A. C., Kwon, K., Krosky, D. J. & Stivers, J. T. (2002). Nature Struct. Biol. 9, 659–664.  Web of Science CrossRef PubMed CAS Google Scholar
First citationEmsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126–2132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEngelward, B. P., Dreslin, A., Christensen, J., Huszar, D., Kurahara, C. & Samson, L. (1996). EMBO J. 15, 945–952.  CAS PubMed Web of Science Google Scholar
First citationEvans, P. (2006). Acta Cryst. D62, 72–82.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationForsyth, R. A. et al. (2002). Mol. Microbiol. 43, 1387–1400.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHollis, T., Ichikawa, Y. & Ellenberger, T. (2000). EMBO J. 19, 758–766.  Web of Science CrossRef PubMed CAS Google Scholar
First citationJi, Y., Zhang, B., Van Horn, S. F., Warren, P., Woodnutt, G., Burnham, M. K. & Rosenberg, M. (2001). Science, 293, 2266–2269.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationLabahn, J., Schärer, O. D., Long, A., Ezaz-Nikpay, K., Verdine, G. L. & Ellenberger, T. E. (1996). Cell, 86, 321–329.  CrossRef CAS PubMed Web of Science Google Scholar
First citationLau, A. Y., Wyatt, M. D., Glassner, B. J., Samson, L. D. & Ellenberger, T. (2000). Proc. Natl Acad. Sci. USA, 97, 13573–13578.  Web of Science CrossRef PubMed CAS Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMetz, A. H., Hollis, T. & Eichman, B. F. (2007). EMBO J. 26, 2411–2420.  Web of Science CrossRef PubMed CAS Google Scholar
First citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationO'Brien, P. J. & Ellenberger, T. (2004). J. Biol. Chem. 279, 9750–9757.  Web of Science PubMed CAS Google Scholar
First citationOke, M. et al. (2010). J. Struct. Funct. Genomics, 11, 167–180.  CrossRef CAS PubMed Google Scholar
First citationOtwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326.  CrossRef CAS Web of Science Google Scholar
First citationPainter, J. & Merritt, E. A. (2006). J. Appl. Cryst. 39, 109–111.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationPotterton, E., Briggs, P., Turkenburg, M. & Dodson, E. (2003). Acta Cryst. D59, 1131–1137.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationRiazuddin, S. & Lindahl, T. (1978). Biochemistry, 17, 2110–2118.  CrossRef CAS PubMed Web of Science Google Scholar
First citationSedgwick, B., Bates, P. A., Paik, J., Jacobs, S. C. & Lindahl, T. (2007). DNA Repair, 6, 429–442.  Web of Science CrossRef PubMed CAS Google Scholar
First citationSharma, S. & Lee, J. K. (2002). J. Org. Chem. 67, 8360–8365.  Web of Science CrossRef PubMed CAS Google Scholar
First citationWinn, M. D. et al. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Volume 68| Part 6| June 2012| Pages 610-615
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds