crystallization communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Crystallization and structure determination of a symmetrical `football' complex of the mammalian mitochondrial Hsp60–Hsp10 chaperonins

CROSSMARK_Color_square_no_text.svg

aDepartment of Biochemistry and Molecular Biology, George S. Wise Faculty of Life Sciences, Tel Aviv University, 69978 Tel Aviv, Israel, bThe Daniella Rich Institute for Structural Biology, George S. Wise Faculty of Life Sciences, Tel Aviv University, 69978 Tel Aviv, Israel, and cDepartment of Molecular Microbiology and Biotechnology, George S. Wise Faculty of Life Sciences, Tel Aviv University, 69978 Tel Aviv, Israel
*Correspondence e-mail: [email protected], [email protected]

(Received 23 October 2013; accepted 15 December 2013; online 24 December 2013)

The mitochondrial Hsp60–Hsp10 complex assists the folding of various proteins impelled by ATP hydrolysis, similar to the bacterial chaperonins GroEL and GroES. The near-atomic structural details of the mitochondrial chaperonins are not known, despite the fact that almost two decades have passed since the structures of the bacterial chaperonins became available. Here, the crystallization procedure, diffraction experiments and structure determination by molecular replacement of the mammalian mitochondrial chaperonin HSP60 (E321K mutant) and its co-chaperonin Hsp10 are reported.

1. Introduction

Mammalian cells contain two types of 60 kDa chaperonin proteins, one residing in the cytosol and the other within the mitochondrial matrix. The latter protein belongs to the type I chaperonin family that is also found in eubacteria and chloroplasts. The proteins of this family play a vital role in mediating the folding of newly translated, imported or stress-denatured proteins in an ATP-dependent manner (Cheng et al., 1989[Cheng, M. Y., Hartl, F.-U., Martin, J., Pollock, R. A., Kalousek, F., Neupert, W., Hallberg, E. M., Hallberg, R. L. & Horwich, A. L. (1989). Nature (London), 337, 620-625.]; Levy-Rimler et al., 2002[Levy-Rimler, G., Bell, R. E., Ben-Tal, N. & Azem, A. (2002). FEBS Lett. 529, 1-5.]; Bross et al., 2012[Bross, P., Magnoni, R. & Bie, A. S. (2012). Curr. Top. Med. Chem. 12, 2491-2503.]).

Owing to the ready availability and the marked stability of the bacterial chaperonin system, most of our understanding of chaperonin structure and function comes from investigation of the GroE chaperonin proteins (GroEL and GroES) from Escherichia coli. The crystal structure of GroEL was solved almost two decades ago, revealing a molecule comprised of 14 60 kDa subunits that are organized in two heptameric rings stacked back to back (PDB entries 1grl and 1aon ; Braig et al., 1994[Braig, K., Otwinowski, Z., Hegde, R., Boisvert, D. C., Joachimiak, A., Horwich, A. L. & Sigler, P. B. (1994). Nature (London), 371, 578-586.]; Xu et al., 1997[Xu, Z., Horwich, A. L. & Sigler, P. B. (1997). Nature (London), 388, 741-750.]). The internal hollow parts of the rings create a central cavity also known as the `Anfinsen cage' (Ellis, 2003[Ellis, R. J. (2003). Curr. Biol. 13, R881-R883.]). Elucidation of the co-chaperonin structure of GroES in the bacterial GroEL–GroES complex showed that it forms a dome-shaped ring consisting of seven identical 10 kDa subunits (Hunt et al., 1996[Hunt, J. F., Weaver, A. J., Landry, S. J., Gierasch, L. & Deisenhofer, J. (1996). Nature (London), 379, 37-45.]). It serves as a `cap' for the Anfinsen cage, allowing the formation of an isolated niche in which the substrate can fold in an ATP-dependent manner (Xu et al., 1997[Xu, Z., Horwich, A. L. & Sigler, P. B. (1997). Nature (London), 388, 741-750.]).

The mitochondrial chaperonins Hsp60 and Hsp10 (mHsp60 and mHsp10) play crucial roles in the folding of newly imported matrix proteins (Ostermann et al., 1989[Ostermann, J., Horwich, A. L., Neupert, W. & Hartl, F.-U. (1989). Nature (London), 341, 125-130.]; Cheng et al., 1989[Cheng, M. Y., Hartl, F.-U., Martin, J., Pollock, R. A., Kalousek, F., Neupert, W., Hallberg, E. M., Hallberg, R. L. & Horwich, A. L. (1989). Nature (London), 337, 620-625.]). Numerous previous studies have revealed that there are some significant differences between the bacterial and the mitochondrial chaperonins with respect to their oligomeric state, the effect of nucleotides on their interaction with co-chaperonins and their ability to function with co-chaperonins from different sources (Parnas et al., 2012[Parnas, A., Nisemblat, S., Weiss, C., Levy-Rimler, G., Pri-Or, A., Zor, T., Lund, P. A., Bross, P. & Azem, A. (2012). PLoS One, 7, e50318.]; Nielsen & Cowan, 1998[Nielsen, K. L. & Cowan, N. J. (1998). Mol. Cell, 2, 93-99.]; Nielsen et al., 1999[Nielsen, K. L., McLennan, N., Masters, M. & Cowan, N. J. (1999). J. Bacteriol. 181, 5871-5875.]; Viitanen et al., 1992[Viitanen, P. V., Gatenby, A. A. & Lorimer, G. H. (1992). Protein Sci. 1, 363-369.]). Moreover, it has been shown (Cappello et al., 2008[Cappello, F., Conway de Macario, E., Marasà, L., Zummo, G. & Macario, A. J. (2008). Cancer Biol. Ther. 7, 801-809.]; Deocaris et al., 2006[Deocaris, C. C., Kaul, S. C. & Wadhwa, R. (2006). Cell Stress Chaperones, 11, 116-128.]; Samali et al., 1999[Samali, A., Cai, J., Zhivotovsky, B., Jones, D. P. & Orrenius, S. (1999). EMBO J. 18, 2040-2048.]; Gupta & Knowlton, 2005[Gupta, S. & Knowlton, A. A. (2005). J. Cell. Mol. Med. 9, 51-58.]; Osterloh et al., 2004[Osterloh, A., Meier-Stiegen, F., Veit, A., Fleischer, B., von Bonin, A. & Breloer, M. (2004). J. Biol. Chem. 279, 47906-47911.]; Czarnecka et al., 2006[Czarnecka, A. M., Campanella, C., Zummo, G. & Cappello, F. (2006). Cancer Biol. Ther. 5, 714-720.]) that mHsp60 also plays key roles outside mitochondria. Altogether, these findings suggest that the mechanism of action of the mammalian mitochondrial chaperonins is distinct from those of the bacterial system. The structural basis underlying the extracellular functions of mHsp60 is still unknown and no high-resolution information is yet available for mHsp60 or its interacting co-chaperonin mHsp10.

To gain insight into the unique properties of mHsp60, we set out to crystallize this protein in complex with its co-chaperonin. Because of the labile nature of mHsp60 and of its complex with mHsp10, we used the previously described mutant mHsp60E321K (Parnas et al., 2012[Parnas, A., Nisemblat, S., Weiss, C., Levy-Rimler, G., Pri-Or, A., Zor, T., Lund, P. A., Bross, P. & Azem, A. (2012). PLoS One, 7, e50318.]). This mutant has been shown to stabilize the open conformation of mHsp60 and to create a very stable complex between mHsp60 and mHsp10. Use of this mutant is expected to stabilize the R′R′ allosteric state of the protein. We report the preparation, purification, crystallization and structure determination by the molecular-replacement method of the mammalian mitochondrial chaperonin complex HSP60–HSP10 at a resolution of 3.34 Å. This structure shows the double-ring football-like assembly of the mHsp60–mHsp10 complex.

2. Materials and methods

2.1. Protein preparation

2.1.1. mHsp60E321K

A DNA fragment encoding mHsp60, corresponding to residues 27–556 of the full-length mHsp60 (GenBank accession No. P10809), was amplified by PCR using the oligo­nucleotide primers listed in Table 1[link]. The PCR product was inserted into modified pET-21d (Iosefson et al., 2007[Iosefson, O., Levy, R., Marom, M., Slutsky-Leiderman, O. & Azem, A. (2007). Protein Sci. 16, 316-322.]) via BamHI and NotI (the restriction sites in the primer sequences are shown in bold) to generate the expression plasmid. Site-directed mutagenesis (E321K mutation) was performed as described by Parnas et al. (2012[Parnas, A., Nisemblat, S., Weiss, C., Levy-Rimler, G., Pri-Or, A., Zor, T., Lund, P. A., Bross, P. & Azem, A. (2012). PLoS One, 7, e50318.]). mHsp60E321K was expressed and purified as described by Parnas et al. (2009[Parnas, A., Nadler, M., Nisemblat, S., Horovitz, A., Mandel, H. & Azem, A. (2009). J. Biol. Chem. 284, 28198-28203.]).

Table 1
Cloning details of the constructs used in this study (Dickson et al., 1994[Dickson, R., Larsen, B., Viitanen, P. V., Tormey, M. B., Geske, J., Strange, R. & Bemis, L. T. (1994). J. Biol. Chem. 269, 26858-26864.])

  SCD_E321K mHsp60 mHsp10
Source organism Human (Homo sapiens) Mouse (Mus musculus)
Forward primer TAAGGATCCGCCAAAGATGTAAAATTT See Viitanen et al. (1992[Viitanen, P. V., Gatenby, A. A. & Lorimer, G. H. (1992). Protein Sci. 1, 363-369.])
Reverse primer TAAGCGGCCGCTTAAGGGTCCTTCTCT See Viitanen et al. (1992[Viitanen, P. V., Gatenby, A. A. & Lorimer, G. H. (1992). Protein Sci. 1, 363-369.])
Expression vector pET-21d, N-terminal His8 tag + TEV protease site pET-24d, C-terminal His6 tag
Complete amino-acid sequence of the construct produced GSAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGKVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDP MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGGKGKSGEIEPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDSDILGKYVDKLAAALEHHHHHH

The purified protein solution consisted of ∼30 mg ml−1 protein, 50 mM Tris–HCl pH 7.7, 300 mM NaCl, 5% glycerol and 10 mM MgCl2.

2.1.2. mHsp10

mHsp10 was cloned and purified as described by Dickson et al. (1994[Dickson, R., Larsen, B., Viitanen, P. V., Tormey, M. B., Geske, J., Strange, R. & Bemis, L. T. (1994). J. Biol. Chem. 269, 26858-26864.]) and Parnas et al. (2009[Parnas, A., Nadler, M., Nisemblat, S., Horovitz, A., Mandel, H. & Azem, A. (2009). J. Biol. Chem. 284, 28198-28203.]) (Table 1[link]). The purified protein solution consisted of ∼30 mg ml−1 protein, 50 mM Tris–HCl pH 7.7 and 100 mM NaCl.

2.2. Crystallization

mHsp60 and mHsp10 were mixed together with 1 mM ATP and incubated for 5 min at 293 K immediately before setting up crystallization drops. Preliminary screening of crystallization conditions was performed using the hanging-drop vapour-diffusion method with the PEGRx 1, PEGRx 2, Index, Natrix, PEG/Ion (Hampton Research) and The JCSG+ Suite (Qiagen) crystallization kits at the Israel Structural Proteomics Center, Weizmann Institute of Science, Rehovot, Israel using a Mosquito crystallization robot (TTP LabTech, Royston, England) at 293 K. Crystals of the mHsp60–mHsp10 complex were observed after 1 d (Fig. 1[link]a). Crystallization conditions were optimized in standard 24-well Linbro plates (Hampton Research) (Fig. 1[link]b, Table 2[link]). These crystals yielded diffraction to 7–8 Å resolution. The diffraction quality was significantly improved by dehydration with PEG 400 (Fig. 1[link]c). In this process, after crystal growth, the cover slips were transferred to reservoirs containing serially increasing PEG 400 concentrations in the mother liquor. The concentration of PEG 400 was increased by 15% in three consecutive steps of 5% with ∼24 h incubation time for each step (35, 40 and 45%). All dehydration procedures were carried out at a temperature of 293 K.

Table 2
Crystallization conditions of the crystals reported in this study

Method Hanging drop
Plate type Linbro
Temperature (K) 303 for 3 d then 293
Protein concentration mHsp60, 9.5 mg ml−1; mHsp10, 1.6 mg ml−1
Buffer composition of protein solution 50 mM Tris–HCl pH 7.7, 300 mM NaCl, 5% glycerol, 15 mM MgCl2, 0.5 mM KCl, 1 mM ATP
Composition of reservoir solution 0.2 M ammonium acetate, 0.1 M sodium citrate tribasic dehydrate, 30–35%(v/v) PEG 400
Volume and ratio of drop 5 µl (1:1)
Volume of reservoir (µl) 500
[Figure 1]
Figure 1
Crystals of the mHsp60E321K–mHsp10 complex obtained from initial screening (a) and after optimization of the crystallization conditions (b). The diffraction pattern (c) extended to 3.5 Å resolution (at the frame edge) after dehydration. Magnification of the diffraction region shows excellent spot separation. Data were collected on beamline ID23-1 at the ESRF.

2.3. Data collection and processing

The dehydrated crystals were harvested from hanging drops using cryo-loops, oriented along the longest axis, plunged into liquid nitrogen and placed in pucks for transportation to the synchrotron at cryogenic temperature. Crystals were mounted in the diffraction position utilizing the standard sample changer at the European Synchrotron Radiation Facility (ESRF), Grenoble, France. Diffraction data were collected, integrated and scaled using DENZO and SCALEPACK as implemented in HKL-2000 (Otwinowski & Minor, 1997[Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307-326.]). Diffraction data statistics are shown in Table 3[link].

Table 3
Data collection and processing

Values in parentheses are for the highest resolution shell.

Diffraction source ID23-1, ESRF
Wavelength (Å) 0.95370
Temperature (K) 100
Detector ADSC Q15
Crystal-to-detector distance (mm) 550.7
Rotation range per image (°) 0.5
Total rotation range (°) 100
Exposure time per image (s) 0.3
Space group P41212
Unit-cell parameters (Å) a = b = 198.11, c = 625.04
Mosaicity range (°) 0.18–0.45
Resolution range (Å) 30–3.34 (3.40–3.34)
Total No. of reflections 1440760 (58205)
No. of unique reflections 179444 (8831)
Completeness (%) 100.0 (100.0)
Multiplicity 8.1 (6.6)
I/σ(I)〉 12.1 (1.2)
CC1/2 for the highest resolution shell 0.527
Rr.i.m. 0.066 (0.584)
Overall B factor from Wilson plot (Å2) 81.1§
†The resolution cutoff decision was made using the approach of Karplus & Diederichs (2012[Karplus, P. A. & Diederichs, K. (2012). Science, 336, 1030-1033.]). 〈I/σ(I)〉 falls below 2.0 at 3.46 Å resolution. The data were collected before the paper describing the CC1/2 approach was published.
‡Calculated by multiplying the conventional Rmerge value by the factor [N/(N − 1)]1/2, where N is the multiplicity.
§The Wilson plot does not show anomalies.

2.4. Crystal structure determination

By implementing the molecular-replacement method, the structure of the complex was successfully determined using as a model the GroEL seven-member upper extended ring (cis ring) together with its bound GroES seven-membered lid (with 48.6% identity to the sequence of the mammalian mitochondrial chaperonin and 32.7% identity to that of the co-chaperonin) derived from PDB entry 1aon (Xu et al., 1997[Xu, Z., Horwich, A. L. & Sigler, P. B. (1997). Nature (London), 388, 741-750.]). The molecular-replacement program MOLREP (v.11.1.03; Vagin & Teplyakov, 2010[Vagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22-25.]) was used as implemented in the CCP4 suite (v.6.3.0; Winn et al., 2011[Winn, M. D. et al. (2011). Acta Cryst. D67, 235-242.]). Solute molecules and ATP/ADP cofactors were deleted from the model coordinate file. The model coordinates were not trimmed to the unequivocal structure. The molecular-replacement solution (score 0.233, translation-function peak/noise 17.92 and contrast 12.38) revealed that 14 mHsp60 and 14 mHsp10 molecules were arranged in an elliptical `football'-like assembly.

Refinement of the structure started at Rmodel = 0.5169 and Rfree = 0.5164 and reached Rmodel = 0.3595 and Rfree = 0.4176 after 100 cycles of refinement using REFMAC (v.5.7.32; Murshudov et al., 2011[Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355-367.]) with activated jelly-body option, the use of secondary-structure restraints as generated by ProSMART (v.0.816; Nicholls et al., 2012[Nicholls, R. A., Long, F. & Murshudov, G. N. (2012). Acta Cryst. D68, 404-417.]) and the application of NCS torsion-angle restraints, unequivocally supporting the correctness of the molecular-replacement solution. The GroEL–GroES sequence was still preserved after the initial refinement. Fig. 2[link] presents the Cα trace of the determined structure in cross-eyed stereo. Refinement and rebuilding of the structure are currently under way in our laboratory.

[Figure 2]
Figure 2
Wall-eyed stereoview of the Cα trace of the structure of the mHsp60E321K–mHsp10 complex.

3. Conclusion

We report the first X-ray structural determination of the mammalian mitochondrial Hsp60–Hsp10 complex. The structure revealed a symmetrical `football'-shaped complex of the chaperonin in complex with the co-chaperonin. The formation of symmetrical complexes was demonstrated for the first time for GroEL–GroES complexes from E. coli using a variety of low-resolution methods (Azem et al., 1994[Azem, A., Kessel, M. & Goloubinoff, P. (1994). Science, 265, 653-656.]; Schmidt et al., 1994[Schmidt, M., Rutkat, K., Rachel, R., Pfeifer, G., Jaenicke, R., Viitanen, P., Lorimer, G. & Buchner, J. (1994). Science, 265, 656-659.]; Todd et al., 1994[Todd, M. J., Viitanen, P. V. & Lorimer, G. H. (1994). Science, 265, 659-666.]; Harris et al., 1994[Harris, J. R., Plückthun, A. & Zahn, R. (1994). J. Struct. Biol. 112, 216-230.]; Llorca et al., 1994[Llorca, O., Marco, S., Carrascosa, J. L. & Valpuesta, J. M. (1994). FEBS Lett. 345, 181-186.]). To the best of our knowledge, however, no high-resolution X-­ray structure has been published to date for a symmetrical complex of chaperonins.

Acknowledgements

We thank the ESRF, Grenoble, France for use of the macromolecular crystallographic data-collection facilities and the ID23-1 staff for their assistance. This work was supported by a grant from the Morasha program of the Israel Science Foundation (Grant 1902/08) and Israel Science Foundation Grant 452/09 (to AA) and by an Eshkol Fellowship from the Ministry of Science (to SN)

References

First citationAzem, A., Kessel, M. & Goloubinoff, P. (1994). Science, 265, 653–656.  CrossRef CAS PubMed Web of Science Google Scholar
First citationBraig, K., Otwinowski, Z., Hegde, R., Boisvert, D. C., Joachimiak, A., Horwich, A. L. & Sigler, P. B. (1994). Nature (London), 371, 578–586.  CrossRef CAS PubMed Web of Science Google Scholar
First citationBross, P., Magnoni, R. & Bie, A. S. (2012). Curr. Top. Med. Chem. 12, 2491–2503.  CrossRef CAS PubMed Google Scholar
First citationCappello, F., Conway de Macario, E., Marasà, L., Zummo, G. & Macario, A. J. (2008). Cancer Biol. Ther. 7, 801–809.  CrossRef PubMed CAS Google Scholar
First citationCheng, M. Y., Hartl, F.-U., Martin, J., Pollock, R. A., Kalousek, F., Neupert, W., Hallberg, E. M., Hallberg, R. L. & Horwich, A. L. (1989). Nature (London), 337, 620–625.  CrossRef CAS PubMed Web of Science Google Scholar
First citationCzarnecka, A. M., Campanella, C., Zummo, G. & Cappello, F. (2006). Cancer Biol. Ther. 5, 714–720.  Web of Science CrossRef PubMed CAS Google Scholar
First citationDeocaris, C. C., Kaul, S. C. & Wadhwa, R. (2006). Cell Stress Chaperones, 11, 116–128.  Web of Science CrossRef PubMed CAS Google Scholar
First citationDickson, R., Larsen, B., Viitanen, P. V., Tormey, M. B., Geske, J., Strange, R. & Bemis, L. T. (1994). J. Biol. Chem. 269, 26858–26864.  CAS PubMed Web of Science Google Scholar
First citationEllis, R. J. (2003). Curr. Biol. 13, R881–R883.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGupta, S. & Knowlton, A. A. (2005). J. Cell. Mol. Med. 9, 51–58.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHarris, J. R., Plückthun, A. & Zahn, R. (1994). J. Struct. Biol. 112, 216–230.  CrossRef CAS PubMed Web of Science Google Scholar
First citationHunt, J. F., Weaver, A. J., Landry, S. J., Gierasch, L. & Deisenhofer, J. (1996). Nature (London), 379, 37–45.  CrossRef CAS PubMed Web of Science Google Scholar
First citationIosefson, O., Levy, R., Marom, M., Slutsky-Leiderman, O. & Azem, A. (2007). Protein Sci. 16, 316–322.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKarplus, P. A. & Diederichs, K. (2012). Science, 336, 1030–1033.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLevy-Rimler, G., Bell, R. E., Ben-Tal, N. & Azem, A. (2002). FEBS Lett. 529, 1–5.  Web of Science PubMed CAS Google Scholar
First citationLlorca, O., Marco, S., Carrascosa, J. L. & Valpuesta, J. M. (1994). FEBS Lett. 345, 181–186.  CrossRef CAS PubMed Web of Science Google Scholar
First citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationNicholls, R. A., Long, F. & Murshudov, G. N. (2012). Acta Cryst. D68, 404–417.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationNielsen, K. L. & Cowan, N. J. (1998). Mol. Cell, 2, 93–99.  Web of Science CrossRef CAS PubMed Google Scholar
First citationNielsen, K. L., McLennan, N., Masters, M. & Cowan, N. J. (1999). J. Bacteriol. 181, 5871–5875.  Web of Science PubMed CAS Google Scholar
First citationOsterloh, A., Meier-Stiegen, F., Veit, A., Fleischer, B., von Bonin, A. & Breloer, M. (2004). J. Biol. Chem. 279, 47906–47911.  Web of Science CrossRef PubMed CAS Google Scholar
First citationOstermann, J., Horwich, A. L., Neupert, W. & Hartl, F.-U. (1989). Nature (London), 341, 125–130.  CrossRef CAS PubMed Web of Science Google Scholar
First citationOtwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326.  CrossRef CAS Web of Science Google Scholar
First citationParnas, A., Nadler, M., Nisemblat, S., Horovitz, A., Mandel, H. & Azem, A. (2009). J. Biol. Chem. 284, 28198–28203.  Web of Science CrossRef PubMed CAS Google Scholar
First citationParnas, A., Nisemblat, S., Weiss, C., Levy-Rimler, G., Pri-Or, A., Zor, T., Lund, P. A., Bross, P. & Azem, A. (2012). PLoS One, 7, e50318.  Web of Science CrossRef PubMed Google Scholar
First citationSamali, A., Cai, J., Zhivotovsky, B., Jones, D. P. & Orrenius, S. (1999). EMBO J. 18, 2040–2048.  Web of Science CrossRef PubMed CAS Google Scholar
First citationSchmidt, M., Rutkat, K., Rachel, R., Pfeifer, G., Jaenicke, R., Viitanen, P., Lorimer, G. & Buchner, J. (1994). Science, 265, 656–659.  CrossRef CAS PubMed Web of Science Google Scholar
First citationTodd, M. J., Viitanen, P. V. & Lorimer, G. H. (1994). Science, 265, 659–666.  CrossRef CAS PubMed Web of Science Google Scholar
First citationVagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22–25.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationViitanen, P. V., Gatenby, A. A. & Lorimer, G. H. (1992). Protein Sci. 1, 363–369.  CrossRef PubMed CAS Google Scholar
First citationWinn, M. D. et al. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationXu, Z., Horwich, A. L. & Sigler, P. B. (1997). Nature (London), 388, 741–750.  CAS PubMed Web of Science Google Scholar

© International Union of Crystallography. Prior permission is not required to reproduce short quotations, tables and figures from this article, provided the original authors and source are cited. For more information, click here.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds