crystallization communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Crystallization and preliminary X-ray diffraction studies of a surface mutant of the middle domain of PB2 from human influenza A (H1N1) virus

CROSSMARK_Color_square_no_text.svg

aFaculty of Life Sciences, Kyoto Sangyo University, Kamigamo-Motoyama, Kyoto 603-8555, Japan
*Correspondence e-mail: [email protected]

(Received 8 October 2013; accepted 30 November 2013; online 24 December 2013)

In the last hundred years, four influenza pandemics have been experienced, beginning with that in Spain in 1918. Influenza A virus causes severe pneumonia and its RNA polymerase is an important target for drug design. The influenza A (H1N1) virus has eight ribonucleoprotein complexes, which are composed of viral RNA, RNA polymerases and nucleoproteins. PB2 forms part of the RNA polymerase complex and plays an important role in binding to the cap structure of host mRNA. The middle domain of PB2 includes a cap-binding site. The structure of PB2 from H1N1 complexed with m7GTP has not been reported. Plate-like crystals of the middle domain of PB2 from H1N1 were obtained, but the quality of these crystals was not good. An attempt was made to crystallize the middle domain of PB2 complexed with m7GTP using a soaking method; however, electron density for m7GTP was not observed on preliminary X-ray diffraction analysis. This protein has hydrophobic residues on its surface and is stable in the presence of high salt concentrations. To improve the solubility, a surface double mutant (P453H and I471T) was prepared. These mutations change the surface electrostatic potential drastically. The protein was successfully prepared at a lower salt concentration and good cube-shaped crystals were obtained using this protein. Here, the crystallization and preliminary X-ray diffraction analysis of this mutant of the middle domain of PB2 are reported.

1. Introduction

The seasonal influenza virus causes respiratory inflammation, high fever, headache and muscle aches, and fatigue. In the pandemic in 1918, the influenza virus (known as Spanish influenza) also caused severe pneumonia, causing the deaths of 50 million victims worldwide (Reid et al., 2001[Reid, A. H., Taubenberger, J. K. & Fanning, T. G. (2001). Microbes Infect. 3, 81-87.]). Subsequent to this pandemic, humans have been attacked by three further influenza pandemics: Asian influenza (H2N2) in 1957, Hong Kong influenza (H3N2) in 1968 and H1N1 influenza in 2009.

The influenza A virus belongs to the Orthomyxoviridae and has eight viral ribonucleoprotein (vRNP) complexes, which are composed of viral RNA (vRNA), vRNA-dependent RNA polymerases and nucleoproteins (NPs). The vRNP complexes are the basic unit for transcription and replication (Elton et al., 2005[Elton, D., Digard, P., Tiley, L. & Ortin, J. (2005). Influenza Virology: Current Topics, edited by Y. Kawaoka, pp. 1-36. Wymondham: Caister Academic Press.]). vRNA is a single-stranded negative chain associated with the RNA polymerase and NPs. The RNA polymerase is a heterotrimer composed of three subunits: polymerase acidic protein (PA), polymerase basic protein 1 (PB1) and polymerase basic protein 2 (PB2). This multi-subunit complex performs transcription from negative vRNA to positive vRNA and replication of negative vRNA via the replication of complementary DNA.

In the transcription reaction, as a first step PB2 binds the cap structure of host 5′-capped mRNA, such as that of 7-methylguanosine 5′-­triphosphate (m7GTP). In the second step, the captured host mRNA is cleaved after 10–13 nucleotides by the endonuclease activity of the PA subunit. Finally, the PB1 subunit plays a central role in the elongation of positive vRNA using the cleaved oligonucleotide as a primer (Plotch et al., 1981[Plotch, S. J., Bouloy, M., Ulmanen, I. & Krug, R. M. (1981). Cell, 23, 847-858.]).

The PB2 subunit plays a key role in cap binding using its middle domain. Furthermore, PB2 displays a bipartite nuclear localization signal (NLS) in the C-terminal domain and is transported to the nucleus (Mukaigawa & Nayak, 1991[Mukaigawa, J. & Nayak, D. P. (1991). J. Virol. 65, 245-253.]). Additionally, residues 627 and 701 in the C-terminal domain of PB2 have been identified to be important factors in host range and pathogenicity (Subbarao et al., 1993[Subbarao, E. K., Kawaoka, Y. & Murphy, B. R. (1993). J. Virol. 67, 7223-7228.]; Hatta et al., 2001[Hatta, M., Gao, P., Halfmann, P. & Kawaoka, Y. (2001). Science, 293, 1840-1842.]; Steel et al., 2009[Steel, J., Lowen, A. C., Mubareka, S. & Palese, P. (2009). PLoS Pathog. 5, e1000252.]). Crystal structures of the C-­terminal domain of PB2 have been reported by us and by others (Tarendeau et al., 2008[Tarendeau, F., Crepin, T., Guilligay, D., Ruigrok, R. W., Cusack, S. & Hart, D. J. (2008). PLoS Pathog. 4, e1000136.]; Kuzuhara et al., 2009[Kuzuhara, T., Kise, D., Yoshida, H., Horita, T., Murazaki, Y., Nishimura, A., Echigo, N., Utsunomiya, H. & Tsuge, H. (2009). J. Biol. Chem. 284, 6855-6860.]). Our structure is the first deposited structure of a PB2 C-terminal domain containing the pathogenicity-determinant lysine residue at position 627 in the Protein Data Bank (PDB entry 3cw4 ), and we also revealed that the RNA-binding ability of this domain is enhanced by an E627K mutation (Kuzuhara et al., 2009[Kuzuhara, T., Kise, D., Yoshida, H., Horita, T., Murazaki, Y., Nishimura, A., Echigo, N., Utsunomiya, H. & Tsuge, H. (2009). J. Biol. Chem. 284, 6855-6860.]).

The cap-binding site is located in the middle domain of PB2. Crystal structures of this domain from three strains have been reported: human H1N1 PB2 middle domain without m7GTP (Liu, Meng et al., 2013[Liu, Y., Meng, G., Luo, M. & Zheng, X. (2013). Acta Cryst. F69, 280-283.]), human H3N2 PB2 middle domain with m7GTP (Guilligay et al., 2008[Guilligay, D., Tarendeau, F., Resa-Infante, P., Coloma, R., Crepin, T., Sehr, P., Lewis, J., Ruigrok, R. W., Ortin, J., Hart, D. J. & Cusack, S. (2008). Nature Struct. Mol. Biol. 15, 500-506.]; Liu, Qin et al., 2013[Liu, Y., Qin, K., Meng, G., Zhang, J., Zhou, J., Zhao, G., Luo, M. & Zheng, X. (2013). J. Biol. Chem. 288, 11013-11023.]) and human H5N1 PB2 middle domain with m7GTP (Liu, Qin et al., 2013[Liu, Y., Qin, K., Meng, G., Zhang, J., Zhou, J., Zhao, G., Luo, M. & Zheng, X. (2013). J. Biol. Chem. 288, 11013-11023.]). However, the structure of the middle domain of PB2 from H1N1 complexed with m7GTP has not been reported.

We obtained the human H1N1 PB2 middle-domain protein under high-salt conditions and also obtained crystals. Because the crystals were not of good quality, we collected a data set with considerable difficulty. Although we obtained a crystal of the middle domain of PB2 with m7GTP by a soaking method using this crystal, electron density for m7GTP was not observed on preliminary structural analysis. The surface of the PB2 middle-domain molecule tends to be hydrophobic and thus the protein is solubilized in the presence of high salt concentrations. Therefore, we prepared the middle domain of PB2 with mutations of two amino acids (P453H and I471T), resulting in an increase in the solubility of the protein. Here, we report the crystallization and preliminary X-ray diffraction analysis of the PB2 middle-domain mutant.

2. Materials and methods

2.1. Cloning, mutation, expression and purification of the middle domain of PB2

The pb2 gene (RIKEN) was inferred from the amino-acid sequence of influenza virus H1N1 (A/Puerto Rico/8/1934). We used DNA encoding residues 318–483 subcloned into the pET-15b vector between the NdeI and BamHI sites. The PB2 middle domain in pET-­15b was mutated using the QuikChange Lightning Multi Site-Directed Mutagenesis Kit (Agilent Technologies) according to the manufacturer's instructions to convert proline to histidine at position 453 using the primer 5′-GGGAGTTGAACATATCGACAATGTG-3′. To convert isoleucine to threonine at position 471, the P453H mutant was then mutated using the primers 5′-GACTCCAAGC­ACCGAGATGTCAATG-3′ and 5′-CATTGACATCTCGGTGCT­TGGGAGTC-3′ using PrimeSTAR HS DNA Polymerase (Takara Bio Inc.) according to the manufacturer's instructions. The middle domain of PB2 was then expressed with an N-terminal histidine tag and a thrombin cleavage site in Escherichia coli BL21-CodonPlus-RIL cells (Agilent Technologies) grown in LB medium. The protein was purified by affinity capture on a Protino Ni–IDA 2000 column (Macherey–Nagel). After elution with imidazole, the protein was cleaved with thrombin, loaded onto a Uno S column (Bio-Rad) and eluted with a salt gradient (0.5–1 M NaCl). The eluted wild-type PB2 middle domain was then concentrated to 10 mg ml−1 in 50 mM Tris–HCl pH 8.0, 500 mM NaCl, 2 mM DTT and stored at −80°C. The double mutant of the middle domain of PB2 was purified using the same steps as used for the wild type and was then concentrated to 10 mg ml−1 in 50 mM Tris–HCl pH 8.0, 200 mM NaCl, 2 mM DTT. The amino-acid sequence of the middle domain of PB2 with two mutations was 318RISSSFSFGGFTFKRTSGSSVKREEEVLTGNL­QTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRD­EQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGVEHIDNVMGMIGILPDMTPSTEMSMRGVRISKM483. The residues in bold indicate the locations of the two mutations. An additional four residues derived from the expression vector were present at both the N-terminus and the C-­terminus: 314GSHM317 and 481GSGC484, respectively.

2.2. Crystallization, data collection and model building

Crystals of the wild type were grown using the hanging-drop vapour-diffusion method. The protein solution was mixed with an equal volume of well solution [0.1 M NaH2PO4, 0.1 M KH2PO4, 0.1 M MES pH 5.9, 0.8 M NaCl, 4%(v/v) 1-propanol] and incubated at 4°C. Crystals were picked up using a nylon loop. They were then dipped into mother liquor containing 20%(v/v) glycerol as a cryoprotectant and plunged into a nitrogen-gas stream at 100 K. The data were collected using an X-ray wavelength of 1.0 Å and a Quantum 210r detector on beamline AR-NW12A at the KEK Photon Factory (PF), Tsukuba, Japan. The X-ray data were processed using HKL-2000 and the diffraction images were integrated and scaled using DENZO and SCALEPACK (Otwinowski & Minor, 1997[Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307-326.]). The crystal space group was determined to be I212121. The initial phase was obtained by molecular replacement (MOLREP in CCP4; Vagin & Teplyakov, 2010[Vagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22-25.]; Winn et al., 2011[Winn, M. D. et al. (2011). Acta Cryst. D67, 235-242.]) using the H3N2 cap-binding domain structure (PDB entry 2vqz ; Guilligay et al., 2008[Guilligay, D., Tarendeau, F., Resa-Infante, P., Coloma, R., Crepin, T., Sehr, P., Lewis, J., Ruigrok, R. W., Ortin, J., Hart, D. J. & Cusack, S. (2008). Nature Struct. Mol. Biol. 15, 500-506.]) as a model. The structure was refined using REFMAC5 restrained refinement in CCP4 (Murshudov et al., 2011[Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355-367.]) and the rebuilding process was performed using Coot (Emsley & Cowtan, 2004[Emsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126-2132.]).

For the double mutant of the middle domain of PB2, the protein solution was mixed with an equal volume of well solution [1.2 M NaCl, 2.5%(v/v) ethanol] and crystals were grown using the hanging-drop vapour-diffusion method at 4°C. Data collection was carried out in the same way as for the wild type except that mother liquor containing 20%(v/v) ethylene glycol was used as a cryoprotectant. The preliminary data were collected using an X-ray wavelength of 1.54 Å and an R-AXIS VII detector system on a MicroMax-007 HF generator (Rigaku) in our laboratory. The X-ray data were processed using the same steps as used for the wild type. The crystal space group was determined to be R32.

3. Results and discussion

We purified His-tagged middle domain of PB2 from H1N1 using a nickel chelate column and the protocol reported by Guilligay et al. (2008[Guilligay, D., Tarendeau, F., Resa-Infante, P., Coloma, R., Crepin, T., Sehr, P., Lewis, J., Ruigrok, R. W., Ortin, J., Hart, D. J. & Cusack, S. (2008). Nature Struct. Mol. Biol. 15, 500-506.]). However, aggregation of the protein was observed in 200 mM NaCl solution. The middle domain of PB2 from H1N1 thus appears to be less soluble than the middle domain of PB2 from H3N2. We modified the protocol to elute the protein with 500 mM NaCl and found that the middle domain of PB2 from H1N1 was stable under these high-salt conditions. Upon crystallization, clustered plate-like crystals appeared within 2–5 d under high-salt conditions (Fig. 1[link]a). We collected a preliminary data set to 2.42 Å resolution from a single crystal and found that the space group was I212121, with unit-cell parameters a = 75.9, b = 103.5, c = 112.5 Å. Molecular-replacement analysis was performed with MOLREP in CCP4 and showed that two PB2 middle-domain molecules were located in the asymmetric unit. The Matthews coefficient value (Matthews, 1968[Matthews, B. W. (1968). J. Mol. Biol. 33, 491-497.]) was 2.99 Å3 Da−1 and corresponds to a solvent content of approximately 60%. The Rwork and Rfree values for the initial solution of two PB2 middle-domain molecules were 45.0 and 43.2%, respectively. Refinement and manual fitting of the model resulted in a final Rwork of 21.8% and Rfree of 27.1%. Other statistics of data collection and structure refinement are given in Table 1[link]. The structure was deposited in the PDB as entry 4j2r . We attempted a soak with m7GTP (2 mM, 30 min) using this crystal, but we were unable to observe any electron density for m7GTP.

Table 1
Data-collection and structure-refinement statistics

Values in parentheses are for the last resolution shell.

  Wild type P453H/I471T double mutant
Data collection
 Unit-cell parameters (Å) a = 75.9, b = 103.5, c = 112.5 a = 108.0, b = 108.0, c = 137.6
 Space group I212121 R32
 Beamline AR-NW12A, PF MicroMax-007 HF
 Detector Quantum 210r R-AXIS VII
 Data-collection range (°) 0–180 0–240
 Oscillation (°) 1 0.5
 Exposure time (s) 1 60
 Mosaicity (°) 1.486 0.585
 Resolution (Å) 50.0–2.40 (2.48–2.40) 50.0–2.30 (2.38–2.30)
 Total No. of reflections 116427 (10541) 99657 (9611)
 No. of unique reflections 16436 (1495) 13943 (1367)
 Completeness (%) 92.4 (85.4) 100.0 (100.0)
Rmerge 0.061 (0.465) 0.093 (0.680)
Rmeas 0.066 (0.502) 0.100 (0.734)
Rp.i.m.§ 0.025 (0.187) 0.037 (0.276)
 〈I/σ(I)〉 27.1 (4.7) 21.4 (4.1)
 Multiplicity 7.1 (7.1) 7.1 (7.0)
Refinement
Rwork 0.218  
Rfree†† 0.271  
 R.m.s.d., bond lengths (Å) 0.015  
 R.m.s.d., bond angles (°) 1.787  
 Matthews coefficient (Å3 Da−1) 2.99  
 No. of molecules in asymmetric unit 2  
 Solvent content (%) 58.8  
 No. of atoms in the model 2582  
 No. of water molecules 71  
 No. of residues in outlier region of Ramachandran plot 0  
 Wilson B factor (Å2) 51.1  
 Average B factor (Å2) 58.0  
Rmerge = Mathematical equationMathematical equation.
Rmeas = Mathematical equationMathematical equation.
§Rp.i.m. = Mathematical equationMathematical equation, where Ii(hkl) is the ith intensity measurement of reflection hkl, 〈I(hkl)〉 is the mean intensity for this reflection and N(hkl) is the multiplicity.
Rwork = Mathematical equationMathematical equation.
††Rfree was calculated using randomly selected reflections (5%).
[Figure 1]
Figure 1
Crystals of the middle domain of PB2 from H1N1. (a) Wild-type crystals, (b) double-mutant (P453H, I471T) crystals. The scale bars represent 200 µm.

Therefore, we produced the middle domain of PB2 with two mutations (P453H and I471T) on the surface. These mutations, which are not near the cap-binding site, change the electrostatic surface from hydrophobic to hydrophilic and resulted in an improvement in the solubility. We screened the crystallization conditions of the mutant in the apo state and obtained crystals under different conditions to those used for the wild type. The crystal shape was improved: a single thick cube-shaped crystal (Fig. 1[link]b) appeared within one week. We tested the diffraction using a small crystal (<0.1 mm) and collected a preliminary X-ray diffraction data set at 2.30 Å resolution using a MicroMax-007 HF rotating-anode X-ray generator (Rigaku; Fig. 2[link]). The crystal space group was determined to be R32, with unit-cell parameters a = 107.8, b = 107.8, c = 136.6 Å. The statistics of data collection are described in Table 1[link]. The crystals usually grew to 0.4 mm in size and we can therefore expect to obtain good data sets using a synchrotron light source.

[Figure 2]
Figure 2
A representative 0.5° oscillation image of data collected from a crystal of the PB2 middle-domain double mutant using an R-AXIS VII detector in our laboratory.

In summary, we improved the solubility of the middle domain of PB2 using two mutations and succeeded in the crystallization of this mutant. Using the double surface mutant crystals, we are now attempting to obtain high-resolution data using a synchrotron light source in order to reveal the substrate-binding mechanism of m7GTP in the middle domain of PB2 from the H1N1 strain.

Acknowledgements

This work was supported in part by a Strategic Research Foundation Grant-aided Project for Private Universities and a Grant-in-Aid for Scientific Research on Innovative Areas, MEXT/JSPS KAKENHI Grant No. 25121733, Japan. The influenza virus (A/PR/8/34) RNA polymerase PB2 plasmid, pBMSA-PB2, was provided by the DNA Bank, RIKEN BioResource Center, Tsukuba, Japan (originally deposited by Dr Susumu Nakada) with the support of the National Bio-Resources Project of MEXT. We thank the staff at KEK PF for data collection.

References

First citationElton, D., Digard, P., Tiley, L. & Ortin, J. (2005). Influenza Virology: Current Topics, edited by Y. Kawaoka, pp. 1–36. Wymondham: Caister Academic Press.  Google Scholar
First citationEmsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126–2132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationGuilligay, D., Tarendeau, F., Resa-Infante, P., Coloma, R., Crepin, T., Sehr, P., Lewis, J., Ruigrok, R. W., Ortin, J., Hart, D. J. & Cusack, S. (2008). Nature Struct. Mol. Biol. 15, 500–506.  Web of Science CrossRef CAS Google Scholar
First citationHatta, M., Gao, P., Halfmann, P. & Kawaoka, Y. (2001). Science, 293, 1840–1842.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKuzuhara, T., Kise, D., Yoshida, H., Horita, T., Murazaki, Y., Nishimura, A., Echigo, N., Utsunomiya, H. & Tsuge, H. (2009). J. Biol. Chem. 284, 6855–6860.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLiu, Y., Meng, G., Luo, M. & Zheng, X. (2013). Acta Cryst. F69, 280–283.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationLiu, Y., Qin, K., Meng, G., Zhang, J., Zhou, J., Zhao, G., Luo, M. & Zheng, X. (2013). J. Biol. Chem. 288, 11013–11023.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMatthews, B. W. (1968). J. Mol. Biol. 33, 491–497.  CrossRef CAS PubMed Web of Science Google Scholar
First citationMukaigawa, J. & Nayak, D. P. (1991). J. Virol. 65, 245–253.  PubMed CAS Web of Science Google Scholar
First citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationOtwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326.  CrossRef CAS Web of Science Google Scholar
First citationPlotch, S. J., Bouloy, M., Ulmanen, I. & Krug, R. M. (1981). Cell, 23, 847–858.  CrossRef CAS PubMed Web of Science Google Scholar
First citationReid, A. H., Taubenberger, J. K. & Fanning, T. G. (2001). Microbes Infect. 3, 81–87.  Web of Science CrossRef PubMed CAS Google Scholar
First citationSteel, J., Lowen, A. C., Mubareka, S. & Palese, P. (2009). PLoS Pathog. 5, e1000252.  Web of Science CrossRef PubMed Google Scholar
First citationSubbarao, E. K., Kawaoka, Y. & Murphy, B. R. (1993). J. Virol. 67, 7223–7228.  CAS PubMed Web of Science Google Scholar
First citationTarendeau, F., Crepin, T., Guilligay, D., Ruigrok, R. W., Cusack, S. & Hart, D. J. (2008). PLoS Pathog. 4, e1000136.  Web of Science CrossRef PubMed Google Scholar
First citationVagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22–25.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationWinn, M. D. et al. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar

© International Union of Crystallography. Prior permission is not required to reproduce short quotations, tables and figures from this article, provided the original authors and source are cited. For more information, click here.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds