research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Crystal structure of pyruvate de­carboxylase from Zymobacter palmae

CROSSMARK_Color_square_no_text.svg

aDepartment of Biology and Biochemistry, University of Bath, Claverton Down, Bath BA2 7AY, England, and bSchool of Science, Faculty of Science and Engineering, University of Waikato, Private Bag 3105, Hamilton 3240, New Zealand
*Correspondence e-mail: [email protected]

Edited by A. Nakagawa, Osaka University, Japan (Received 8 June 2016; accepted 23 July 2016; online 26 August 2016)

Pyruvate decarboxylase (PDC; EC 4.1.1.1) is a thiamine pyrophosphate- and Mg2+ ion-dependent enzyme that catalyses the non-oxidative decarboxylation of pyruvate to acetaldehyde and carbon dioxide. It is rare in bacteria, but is a key enzyme in homofermentative metabolism, where ethanol is the major product. Here, the previously unreported crystal structure of the bacterial pyruvate decarboxylase from Zymobacter palmae is presented. The crystals were shown to diffract to 2.15 Å resolution. They belonged to space group P21, with unit-cell parameters a = 204.56, b = 177.39, c = 244.55 Å and Rr.i.m. = 0.175 (0.714 in the highest resolution bin). The structure was solved by molecular replacement using PDB entry 2vbi as a model and the final R values were Rwork = 0.186 (0.271 in the highest resolution bin) and Rfree = 0.220 (0.300 in the highest resolution bin). Each of the six tetramers is a dimer of dimers, with each monomer sharing its thiamine pyrophosphate across the dimer interface, and some contain ethylene glycol mimicking the substrate pyruvate in the active site. Comparison with other bacterial PDCs shows a correlation of higher thermostability with greater tetramer interface area and number of interactions.

1. Introduction

Pyruvate decarboxylase (PDC; EC 4.1.1.1) catalyses the non-oxidative decarboxylation of pyruvate to acetaldehyde with the release of carbon dioxide, and is a key enzyme in homofermentative metabolism, where ethanol is the main fermentation product. Studies of Zymomonas mobilis PDC showed that its correct folding and activity strongly depend on the binding of the cofactors thiamine pyrophosphate (TPP) and Mg2+ ions (Pohl et al., 1994[Pohl, M., Grötzinger, J., Wollmer, A. & Kula, M. R. (1994). Eur. J. Biochem. 224, 651-661.]).

Zymobacter palmae, which was originally isolated from palm sap (Okamoto et al., 1993[Okamoto, T., Taguchi, H., Nakamura, K., Ikenaga, H., Kuraishi, H. & Yamasato, K. (1993). Arch. Microbiol. 160, 333-337.]), is one of the few bacteria that employs a homofermentative metabolism. It is a Gram-negative, facultatively anaerobic mesophile that is able to utilize a variety of hexose sugars and oligosaccharides in producing ethanol (Horn et al., 2000[Horn, S. J., Aasen, A. M. & Østgaard, K. (2000). J. Ind. Microbiol. Biotechnol. 24, 51-57.]). This is the only member of the Halomonadaceae family that utilizes a PDC in their fermentation metabolism (de la Haba et al., 2010[Haba, R. R. de la, Arahal, D. R., Márquez, M. C. & Ventosa, A. (2010). Int. J. Syst. Evol. Microbiol. 60, 737-748.]).

PDCs are relatively widespread in plants and fungi, but are rarely found in bacteria. To date, only six bacterial PDCs have been described, including that found in Z. palmae (ZpPDC; PDB entry 5euj; this study). The Z. mobilis enzyme (ZmPDC) has been extensively studied, with a variety of structural variants published [PDB entries 1zpd (Dobritzsch et al., 1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]), 2wva, 2wvg and 2wvh (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]), 3oei (Meyer et al., 2010[Meyer, D., Neumann, P., Parthier, C., Friedemann, R., Nemeria, N., Jordan, F. & Tittmann, K. (2010). Biochemistry, 49, 8197-8212.]) and 4zp1 (Wechsler et al., 2015[Wechsler, C., Meyer, D., Loschonsky, S., Funk, L. M., Neumann, P., Ficner, R., Brodhun, F., Müller, M. & Tittmann, K. (2015). Chembiochem, 16, 2580-2584.])]. Other bacterial PDCs include those from Acetobacter pasteurianus (ApPDC; PDB entry 2vbi; D. Gocke, C. L. Berthold, G. Schneider & M. Pohl, unpublished work), Gluconoacetobacter diazotrophicus (GdPDC; PDB entry 4cok; van Zyl, Schubert et al., 2014[Zyl, L. J. van, Schubert, W. D., Tuffin, M. I. & Cowan, D. A. (2014). BMC Struct. Biol. 14, 21.]) and Gluconobacter oxydans (GoPDC; van Zyl, Taylor et al., 2014[Zyl, L. J. van, Taylor, M. P., Eley, K., Tuffin, M. & Cowan, D. A. (2014). Appl. Microbiol. Biotechnol. 98, 1247-1259.]), and from the only known Gram-positive species possessing a PDC, Sarcina ventriculi (SvPDC; Lowe & Zeikus, 1992[Lowe, S. E. & Zeikus, J. G. (1992). J. Gen. Microbiol. 138, 803-807.]).

ZpPDC forms a tetramer from four identical subunits in a dimer-of-dimers fashion. Each subunit consists of 556 amino acids with a molecular mass of 59.4 kDa. Each monomer contains a pyrimidine-binding (PYR) domain, a regulatory (R) domain and a pyrophosphate-binding (PP) domain. The TPP molecules bind across both subunits in each dimer, with the pyrophosphate group binding to the PP domain from one subunit and the pyrimidine ring binding to the PYR domain from the second subunit, thus forming two active sites in the dimer (Fig. 1[link]).

[Figure 1]
Figure 1
Cartoon representation of the ZpPDC dimer. One monomer is coloured blue, with the PYR domain (residues 1–190) in pale blue, the R domain (residues 191–355) in teal and the PP domain (residues 356–556) in dark blue. The second monomer is coloured green, with the PYR domain in pale green, the R domain in bright green and the PP domain in dark green. The active-site magnesium ions are represented as grey spheres and an 1,2-ethanediol molecule bound in the active site of the blue monomer as pink spheres. Two TPP molecules bound between the PYR domain of one monomer and the PP domain of the other nonomer are represented as orange sticks.

Unlike yeast PDCs, bacterial PDCs are not allosterically activated, with the exception of SvPDC (Raj et al., 2002[Raj, K. C., Talarico, L. A., Ingram, L. O. & Maupin-Furlow, J. A. (2002). Appl. Environ. Microbiol. 68, 2869-2876.]). In the first step of the catalytic cycle, TPP is protonated at N-1′ and deprotonated at 4′-NH2. This imino tautomer in turn promotes deprotonation at C2 on the thiazolium ring, thus creating the active ylid. The nucleophilic attack of the ylid on the carbonyl group of pyruvate generates a lactyl adduct (C2-α-lactylthiamine diphosphate intermediate), decarboxylation of which yields the enamine intermediate with concomitant release of carbon dioxide. This intermediate is then protonated, producing hydroxyethyl TPP, and finally the release of acetaldehyde regenerates the ylid (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]; van Zyl, Schubert et al., 2014[Zyl, L. J. van, Schubert, W. D., Tuffin, M. I. & Cowan, D. A. (2014). BMC Struct. Biol. 14, 21.]).

Bacterial PDCs are of great interest for biotechnological applications, in particular for bioethanol production as a second-generation renewable transport fuel. ZmPDC has thus been successfully used to create mesophilic ethanologenic strains of Escherichia coli (Ingram et al., 1987[Ingram, L. O., Conway, T., Clark, D. P., Sewell, G. W. & Preston, J. F. (1987). Appl. Environ. Microbiol. 53, 2420-2425.]), Klebsiella oxytoca (Ingram et al., 1999[Ingram, L. O., Aldrich, H. C., Borges, A. C. C., Causey, T. B., Martinez, A., Morales, F., Saleh, A., Underwood, S. A., Yomano, L. P., York, S. W., Zaldivar, J. & Zhou, S. (1999). Biotechnol. Prog. 15, 855-866.]) and Bacillus spp. (Barbosa & Ingram, 1994[Barbosa, M. de F. S. & Ingram, L. O. (1994). Curr. Microbiol. 28, 279-282.]). Furthermore, ZpPDC has been functionally expressed in Lactococcus lactis (Liu et al., 2005[Liu, S., Dien, B. S. & Cotta, M. A. (2005). Curr. Microbiol. 50, 324-328.]). However, this is by no means an exhaustive list. These earlier studies in mesophilic organisms seemed promising, and in recent years growing interest has developed in utilizing bacterial PDCs for high-temperature ethanol-production processes in thermophilic bacteria. Attempts have been made to express ZmPDC (Thompson et al., 2008[Thompson, A. H., Studholme, D. J., Green, E. M. & Leak, D. J. (2008). Biotechnol. Lett. 30, 1359-1365.]), ZpPDC (Taylor et al., 2008[Taylor, M. P., Esteban, C. D. & Leak, D. J. (2008). Plasmid, 60, 45-52.]) and GoPDC (van Zyl, Taylor et al., 2014[Zyl, L. J. van, Taylor, M. P., Eley, K., Tuffin, M. & Cowan, D. A. (2014). Appl. Microbiol. Biotechnol. 98, 1247-1259.]) in the thermophile Geobacillus thermoglucosidasius, with limited success.

In this study, we present the crystal structure of recombinant ZpPDC at 2.15 Å resolution together with a comparison to the other known bacterial PDCs, thereby increasing the structural information available on these rare enzymes. Thus, we support the quest to understand bacterial PDCs and ongoing protein-engineering efforts.

2. Materials and methods

2.1. Macromolecule production

The gene encoding ZpPDC (annotated in GenBank as AF474145.1) was PCR-amplified from Z. palmae T109 genomic DNA, and included the introduction of PciI and XhoI restriction sites for cloning into pET-28a(+) (Novagen). The resulting construct adds a thrombin cleavage site, a 3×Gly linker and a hexahistidine tag to the C-terminus of the ZpPDC, and was transformed into E. coli BL21(DE3) cells for expression.

For overexpression, the E. coli cells were grown in autoinducing Overnight Express TB (Novagen) medium supplemented with 100 µg ml−1 kanamycin and 5 mM thiamine chloride at 303 K for 16 h with shaking at 220 rev min−1.

The cells were harvested by centrifugation (4000g, 277 K) and resuspended in His-bind buffer (20 mM Tris pH 8, 300 mM NaCl, 20 mM imidazole). The cells were lysed by sonication on ice and the insoluble debris was removed by centrifugation (17 000g, 277 K, 30 min). The supernatant was loaded onto a HisTrap HP (GE Healthcare) 5 ml column for nickel-affinity chromatography. The column was washed with at least ten column volumes of His-bind buffer before eluting the protein with increasing concentrations of His-elute buffer (20 mM Tris pH 8, 300 mM NaCl, 1 M imidazole) on an ÄKTAexplorer FPLC system (GE Healthcare), monitoring the eluted protein at 280 nm.

The eluted protein was buffer-exchanged into 50 mM 2-(N-morpholino)ethanesulfonic acid (MES) pH 6.5, 20 mM MgSO4, 3 mM TPP using a Superdex 200 10/300 GL gel-filtration column (GE Healthcare) on the ÄKTAexplorer FPLC system and was purified to >95% homogeneity as determined by 12% SDS–PAGE analysis.

Protein-activity assays were performed as described in Raj et al. (2002[Raj, K. C., Talarico, L. A., Ingram, L. O. & Maupin-Furlow, J. A. (2002). Appl. Environ. Microbiol. 68, 2869-2876.]) with the reaction mixture consisting of 0.15 mM NADH, 20 mM MgSO4, 3 mM TPP, 29 mM pyruvate, 10 U Saccharomyces cerevisiae alcohol dehydrogenase (Sigma–Aldrich) in 50 mM MES pH 6.5 at 303 K. The temperature optimum was determined as described by Gocke et al. (2009[Gocke, D., Graf, T., Brosi, H., Frindi-Wosch, I., Walter, L., Müller, M. & Pohl, M. (2009). J. Mol. Catal. B Enzym. 61, 30-35.]) following the depletion of pyruvate at 320 nm.

Information relating to the production of recombinant ZpPDC is summarized in Table 1[link].

Table 1
Details relating to the production of recombinant ZpPDC

Source organism Z. palmae strain T109
DNA source Z. palmae strain T109 genomic DNA
Forward primer 5′-TAATACATGTATACCGTTGGTATGTACTTGGCAG-3′
Reverse primer 5′-GTGTACTCGAGGCCGCCGCCGCTGCCGCG-3′
Cloning vector pET-28a(+) (Novagen)
Expression vector pET-28a(+) (Novagen)
Expression host E. coli BL21 (DE3)
Complete amino-acid sequence of the construct produced§ MYTVGMYLAERLAQIGLKHHFAVAGDYNLVLLDQLLLNKDMEQVYCCNELNCGFSAEGYARARGAAAAIVTFSVGAISAMNAIGGAYAENLPVILISGSPNTNDYGTGHILHHTIGTTDYNYQLEMVKHVTCAAESIVSAEEAPAKIDHVIRTALRERKPAYLEIACNVAGAECVRPGPINSLLRELEVDQTSVTAAVDAAVEWLQDRQNVVMLVGSKLRAAAAEKQAVALADRLGCAVTIMAAAKGFFPEDHPNFRGLYWGEVSSEGAQELVENADAILCLAPVFNDYATVGWNSWPKGDNVMVMDTDRVTFAGQSFEGLSLSTFAAALAEKAPSRPATTQGTQAPVLGIEAAEPNAPLTNDEMTRQIQSLITSDTTLTAETGDSWFNASRMPIPGGARVELEMQWGHIGWSVPSAFGNAVGSPERRHIMMVGDGSFQLTAQEVAQMIRYEIPVIIFLINNRGYVIEIAIHDGPYNYIKNWNYAGLIDVFNDEDGHGLGLKASTGAELEGAIKKALDNRRGPTLIECNIAQDDCTETLIAWGKRVAATNSRKPQALVPRGSGGGLEHHHHHH
†The PciI site for cloning is underlined.
‡The XhoI site for cloning is underlined.
§The C-terminal tag containing a thrombin cleavage site, a 3×Gly linker and a hexa-His tag is underlined.

2.2. Crystallization

Crystals of the purified ZpPDC were obtained using the hanging-drop vapour-diffusion method at 291 K. The purified ZpPDC was incubated with 2 mM pyruvate for 30 min at room temperature (293 K), and 2 µl drops of the enzyme/pyruvate solution mixed with crystallization solution [0.15 M sodium citrate pH 5.5, 14%(w/v) PEG 3350] in a 1:1 ratio were placed onto cover slips and equilibrated against 400 µl reservoir solution. Crystals were looped-out and soaked in cryoprotectant [10%(w/v) glycerol added to the crystallization buffer] before flash-cooling and storage in liquid nitrogen. Crystallization information is summarized in Table 2[link].

Table 2
Crystallization conditions

Method Hanging-drop vapour diffusion
Plate type 24-well
Temperature (K) 291
Protein concentration (mg ml−1) 4.8
Buffer composition of protein solution 50 mM MES pH 6.5, 20 mM MgSO4, 3 mM TPP
Composition of reservoir solution 0.15 M sodium citrate pH 5.5, 14%(w/v) PEG 3350
Volume and ratio of drop 2 µl, 1:1
Volume of reservoir (ml) 0.4

2.3. Data collection and processing

X-ray diffraction data were collected to 2.15 Å resolution on beamline MX2 at the Australian Synchrotron (AS) in Melbourne, Australia. AIMLESS (Evans & Murshudov, 2013[Evans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204-1214.]), iMosflm (Battye et al., 2011[Battye, T. G. G., Kontogiannis, L., Johnson, O., Powell, H. R. & Leslie, A. G. W. (2011). Acta Cryst. D67, 271-281.]) and BALBES (Long et al., 2008[Long, F., Vagin, A. A., Young, P. & Murshudov, G. N. (2008). Acta Cryst. D64, 125-132.]) were used for data scaling, data reduction and phasing, respectively. The crystal belonged to space group P21, with unit-cell parameters a = 204.56, b = 177.39, c = 244.55 Å, and contained six tetramers in the asymmetric unit. Data-collection and processing statistics are summarized in Table 3[link].

Table 3
Data collection and processing

Two data collections, with different crystal-to-detector distances and rotation ranges, were combined to form the final data set. Values in parentheses are for the outer resolution shell.

Diffraction source Beamline MX2, AS
Wavelength (Å) 0.9537
Temperature (K) 100.0
Detector ADSC Q315r CCD
Crystal-to-detector distance (mm) 400/300
Rotation range per image (°) 0.5/0.25
Total rotation range (°) 180
Exposure time per image (s) 1
Space group P21
a, b, c (Å) 204.56, 177.39, 244.55
α, β, γ (°) 90, 112.94, 90
Mosaicity (°) 0.3
Resolution range (Å) 75.470–2.150 (2.190–2.150)
Total No. of reflections 5108329 (153406)
No. of unique reflections 858032 (41628)
Completeness (%) 98.9 (96.9)
Multiplicity 6.0 (3.7)
I/σ(I)〉 19.9 (2.3)
Rr.i.m. 0.175 (0.714)
Overall B factor from Wilson plot (Å2) 19.9
†Estimated Rr.i.m. = Rmerge[N/(N − 1)]1/2, where N is the data multiplicity.

2.4. Structure solution and refinement

The structure was solved by molecular replacement using ApPDC (PDB entry 2vbi; 76% amino-acid identity) as the starting model. The structure was refined by iterative cycles of manual building and modelling in Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]) and refinement in REFMAC5 (CCP4 suite; Winn et al., 2001[Winn, M. D. et al. (2011). Acta Cryst. D67, 235-242.]; Potterton et al., 2003[Potterton, E., Briggs, P., Turkenburg, M. & Dodson, E. (2003). Acta Cryst. D59, 1131-1137.]; Murshudov et al., 2011[Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355-367.]). Initially, the noncrystallographic symmetry was used to minimize the rebuilding task; however, in the later stages this was not used and all 24 monomers were refined independently. The quality of the final model was checked using MolProbity (Chen et al., 2010[Chen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12-21.]). The structure has been submitted to the Protein Data Bank and assigned PDB code 5euj. Table 4[link] summarizes the structure-solution and refinement statistics.

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 225.21–2.15 (2.207–2.151)
Completeness (%) 98.8 (97.6)
σ Cutoff F > 0.000σ(F)
No. of reflections, working set 814954 (59398)
No. of reflections, test set 42940 (3176)
Final Rcryst 0.186 (0.271)
Final Rfree 0.220 (0.300)
Cruickshank DPI 0.2148
No. of non-H atoms
 Protein 102016
 Ligand 648
 Solvent 4316
 Total 107004
R.m.s. deviations
 Bonds (Å) 0.008
 Angles (°) 1.307
Average B factors (Å2)
 Protein 26.935
 Ligand 24.626
Ramachandran plot
 Most favoured (%) 98.05
 Allowed (%) 1.91
†Average B factors per chain (Å2): A, 28.241; B, 27.376; C, 21.301; D, 22.281; E, 21.252; F, 18.55; G, 25.637; H, 27.299; I, 25.189; J, 22.729; K, 24.382; L, 23.331; M, 18.054; N, 18.722; O, 24.315; P, 23.331; Q, 27.589; R, 27.29; S, 25.579; T, 24.993; U, 44.654; V, 43.492; W, 47.915; X, 32.927.

3. Results and discussion

3.1. Overall structure

The crystal structure of ZpPDC was determined by molecular replacement using ApPDC (PDB entry 2vbi) as a search model, with the correct solution identified by the presence of electron density for TPP. As described for other bacterial PDCs, the quaternary structure of ZpPDC is a homotetramer, or dimer of dimers. The domains can be assigned as follows: amino acids 1–190, PYR (pyrimidine-binding domain, with 176–190 being a linker); 191–355, R (regulatory domain, with 345–355 being a linker); 356–555, PP (pyrophosphate-binding domain) (Fig. 1[link]). It should be noted that the amino-acid sequence differs from the GenBank entry (AAM49566.1) in two places. The GenBank entry erroneously contains Arg134 and Glu245; both are actually Ala as shown by both our resequencing of the gene and the observed electron density.

The final model contains six tetramers in the asymmetric unit, each with a surface area of 65 000 Å2. It comprises 24 amino-acid chains of 555 amino acids, each with a TPP and a Mg2+ ion, and 4147 water molecules. Comparison of all 24 monomers yielded an average root-mean-square deviation (r.m.s.d.) of 0.173 Å, indicating that the structures are similar. Despite crystallization in the presence of pyruvate, no pyruvate molecules were visible anywhere in the structure, probably owing to catalytic turnover of the substrate to acetaldehyde and subsequent loss of this volatile product. However, six 1,2-ethanediol (EDO) molecules (the PEG monomer) are present, four of which can be found in the active sites in chains I, N, Q and R.

Overall, the electron-density map was of good quality, apart from chains U, V, W and X, which seem exceptionally flexible (Fig. 2[link]). The average B factor for all tetramers is 27 Å2; the average B factor for UVWX is 42 Å2 and the B factors of the individual monomers are also considerably higher within this tetramer (Table 4[link]). Other common flexible areas include the exposed N-terminal Met, the exposed C-terminus and the 340–355 loop, which is the exposed linker between the R and PP domains.

[Figure 2]
Figure 2
Cα representation of the asymmetric unit containing the six tetramers coloured by chain and labelled with the chain name, with the thickness of the trace determined by the B factors. The UVWX tetramer has anomalously high B factors and correspondingly poor electron density.

The final model was refined to an R factor of 18.6% and an Rfree value of 22.3%, using data between 75.40 and 2.15 Å resolution. 98.05% of the residues are located in favoured regions of the Ramachandran plot. In chains G, J, K, M and O, Ser73 is located in the disallowed region, but is well defined in its electron density and seems to be located in a tight bend. This has been noted previously in ZmPDC (Dobritzsch et al., 1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]).

3.2. Functional and structural comparison

Most bacterial PDCs studied so far are very similar in their amino-acid sequences and kinetic parameters, with the exception of SvPDC. It is thought that SvPDC is more closely related to fungal PDCs, whereas the other bacterial PDCs are more similar to plant PDCs (Raj et al., 2002[Raj, K. C., Talarico, L. A., Ingram, L. O. & Maupin-Furlow, J. A. (2002). Appl. Environ. Microbiol. 68, 2869-2876.]). SvPDC is the only PDC to be identified from a Gram-positive bacterium, shares only 31% amino-acid identity with ZpPDC and shows sigmoidal rather than Michaelis–Menten kinetics.

ZpPDC shows a high temperature optimum at 65°C, and retains 80% activity after incubation at 65°C for 30 min (Raj et al., 2002[Raj, K. C., Talarico, L. A., Ingram, L. O. & Maupin-Furlow, J. A. (2002). Appl. Environ. Microbiol. 68, 2869-2876.]; confirmed in this study), making it one of the most thermostable bacterial PDCs currently known. See Table 5[link] for a summary of the properties of known PDCs.

Table 5
Properties of known bacterial PDCs in order of decreasing thermostability

  ZpPDC ApPDC ZmPDC GdPDC GoPDC SvPDC
Gram status Negative Negative Negative Negative Negative Positive
Amino-acid identity (%) Reference 73 63 71 67 31
Temperature optimum (°C) 65 65 60 45–50 53§ NA
Temperature dependence of activity retention 60°C, 100% 50°C, 100% 45°C, 85% NA (half-life at 60°C, 0.3 h) 55°C, 98% 45°C, 95%
65°C, 80% 60°C, 65% 60°C, 65% 60°C, 70% 50°C, 0%
70°C, 0% 65°C, 45% 65°C, 45%   65°C, 40%§  
  70°C, 5% 70°C, 0%      
Kinetics Michaelis–Menten Michaelis–Menten Michaelis–Menten Michaelis–Menten Michaelis–Menten Sigmoidal
Vmax (U mg−1) 165 ± 3 (pH 6.5) 110 ± 2 (pH 6.5) 121 (pH 6.5) 20 (pH 5) 57 (pH 5) 103††
116 ± 2 (pH 6.5) 97 (pH 5) 100 (pH 6) 39 (pH 6) 47 (pH 6) 45 (pH 6.5)
130 (pH 6) 79 (pH 7) 78 (pH 7) 43 (pH 7) 125 (pH 7)§ 35 (pH 7)
140 (pH 7)   120‡‡      
    181§§      
Km (S0.5) (mM) 0.67 ± 0.05 (pH 6.5) 2.8 ± 0.2 (pH 6.5) 1.3 (pH 6.5) 0.06 (pH 5) 0.12 (pH 5) 13††
2.5 ± 0.2 (pH 6.5) 0.39 (pH 5) 0.43 (pH 6) 0.6 (pH 6) 1.2 (pH 6) 5.7 (pH 6.5)
0.24 (pH 6) 5.1 (pH 7) 0.94 (pH 7) 1.2 (pH 7) 2.8 (pH 7)§ 4.0 (pH 7)
0.71 (pH 7)   0.31 (pH 6)¶¶      
    1.1‡‡      
    0.4 (pH 6)§§      
PDB entry 5euj 2vbi 1zpd 4cok NA NA
GenBank gene AF474145 AF368435.1 M15393.2 KJ746104.1 KF650839.1 AAL18557.1
GenBank protein AAM49566.1 AAM21208.1 AAA27696.2 AIG13066.1 AHB37781.1 AF354297.1
R.m.s.d. Reference 0.70 0.70 0.62 NA NA
Q scores Reference 0.94 0.90 0.94 NA NA
†Gocke et al. (2009[Gocke, D., Graf, T., Brosi, H., Frindi-Wosch, I., Walter, L., Müller, M. & Pohl, M. (2009). J. Mol. Catal. B Enzym. 61, 30-35.]).
‡van Zyl, Schubert et al. (2014[Zyl, L. J. van, Schubert, W. D., Tuffin, M. I. & Cowan, D. A. (2014). BMC Struct. Biol. 14, 21.]).
§van Zyl, Taylor et al. (2014[Zyl, L. J. van, Taylor, M. P., Eley, K., Tuffin, M. & Cowan, D. A. (2014). Appl. Microbiol. Biotechnol. 98, 1247-1259.]).
¶Raj et al. (2002[Raj, K. C., Talarico, L. A., Ingram, L. O. & Maupin-Furlow, J. A. (2002). Appl. Environ. Microbiol. 68, 2869-2876.]).
††Lowe & Zeikus (1992[Lowe, S. E. & Zeikus, J. G. (1992). J. Gen. Microbiol. 138, 803-807.]).
‡‡Siegert et al. (2005[Siegert, P., McLeish, M. J., Baumann, M., Iding, H., Kneen, M. M., Kenyon, G. L. & Pohl, M. (2005). Protein Eng. Des. Sel. 18, 345-357.]).
§§Bringer-Meyer et al. (1986[Bringer-Meyer, S., Schimz, K.-L. & Sahm, H. (1986). Arch. Microbiol. 146, 105-110.]).
¶¶Meyer et al. (2010[Meyer, D., Neumann, P., Parthier, C., Friedemann, R., Nemeria, N., Jordan, F. & Tittmann, K. (2010). Biochemistry, 49, 8197-8212.]).

Based on the r.m.s.d. values, the tetramers in PDB entry 5euj are more similar to each other than to other known bacterial PDCs. The MNOP tetramer is the most representative of the six tetramers in PDB entry 5euj, and was used to compare the ZpPDC structure with other known bacterial PDC structures.

The residues involved in interactions on interfaces (i.e. forming hydrogen bonds or salt bridges) are well conserved overall in all bacterial PDCs analysed. Table 6[link] summarizes the interface areas, and Table 7[link] summarizes the numbers of interactions made between different interfaces. A trend of increasing interface area and increasing number of salt bridges can be observed as the thermoactivity and thermostability of the PDCs increase.

Table 6
Comparison of interface areas of known bacterial PDCs in order of decreasing thermostability

  ZpPDC (PDB entry 5euj) ApPDC (PDB entry 2vbi) ZmPDC (PDB entry 1zpd) GdPDC (PDB entry 4cok)
Interface area between monomers within a functional dimer (Å2) 3813.13 3761.3 4144.5 (4387) 3749.8
Percentage of total surface of the monomer 17.08 16.95 18.39 (19.4) 17.83
Interaction area between two functional dimers (Å2) 2912.16 2840 2489.2 (4405) 1851.4
Percentage of total surface of one dimer 13.06 12.78 11.03 (12.1) 8.79
†Dobritzsch et al. (1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]).

Table 7
Comparison of interactions within interfaces of bacterial PDC structures in order of decreasing thermostability

Interactions were determined using PISA. Neighbour, interactions between neighbouring monomers; diagonal, interactions between monomers diagonally across tetrameric centre.

  ZpPDC (PDB entry 5euj) ApPDC (PDB entry 2vbi) ZmPDC (PDB entry 1zpd) GdPDC (PDB entry 4cok)
  Hydrogen bonds Salt bridges Hydrogen bonds Salt bridges Hydrogen bonds Salt bridges Hydrogen bonds Salt bridges
Dimer interface 73 12 61 16 76 (66) 14 (7) 63 13
Major tetramer interface (neighbour) 31 24 34 14 29 (64) 8 (25) 17 9
Minor tetramer interface (diagonal) 2 0 4 0 6 2 4 3
TPP pyrimidine ring 11 0 10 0 12 0 10 0
†Dobritzsch et al. (1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]).

Conserved regions were analysed by using PROMALS3D (Pei et al., 2008[Pei, J., Kim, B.-H. & Grishin, N. V. (2008). Nucleic Acids Res. 36, 2295-2300.]) to generate a structure-based alignment. The PYR and PP domains are well conserved and the R domain and the linker regions much less so. PDB entry 1zpd contains some extra residues in the R and PP domains, as discussed in van Zyl, Schubert et al. (2014[Zyl, L. J. van, Schubert, W. D., Tuffin, M. I. & Cowan, D. A. (2014). BMC Struct. Biol. 14, 21.]). However, none of these factors seem to correlate with the thermostability and thermoactivity differences that are observed between these PDCs.

3.3. The active site and TPP binding

There is good-quality electron-density evidence for a TPP molecule in each of the 24 chains of PDB entry 5euj. However, as noted previously (Dobritzsch et al., 1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]), the bound TPP appears to be chemically modified at C2. The electron-density evidence suggests that the thiazolium ring has been opened and the C2 atom has been lost, as seen in PDB entry 1zpd. This was suggested to be most likely owing to partial degradation of the TPP during crystallization (Dobritzsch et al., 1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]).

Through pseudo-222 symmetry, the four monomers in a tetramer create four cofactor- and substrate-binding sites located in narrow clefts on the interfaces between the PYR domain of one monomer and the PP domain of a second monomer. The TPP molecule binds as indicated by the domain nomenclature (Fig. 1[link]), with the pyrophosphate group binding to the PP domain of one monomer and the pyrimidine ring binding to the PYR domain of a second monomer in the dimer.

Ile410 from the first monomer holds TPP in a V-shape (Fig. 3[link]). The backbone amide groups of Ile467 and Val466 form hydrogen bonds to the O atoms of the pyrophosphate. Glu49 (from the second monomer) forms a hydrogen bond to the N1 atom on the pyrimidine ring. This is essential for the C2 deprotonation mechanism (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]). Other residues involved in TPP binding are Tyr465 and Glu468 from one monomer around the pyrophosphate and Thr71 from the second monomer around the pyrimidine ring.

[Figure 3]
Figure 3
Cartoon and stick depiction of the active site. Residues of one monomer are coloured cyan; residues of the other monomer are coloured green. The magnesium ion (dark grey) and water molecules (blue) are represented as spheres. The 1,2-ethanediol (EDO) and TPP of the cyan chain are shown as stick models and are coloured by atom. Pyruvate (PYR, yellow) has been overlaid following superposition of Z. mobilis PDC (PDB entry 2wva, chain F) and lies on top of the EDO. The 2Fo − Fc density (grey) surrounding the TPP is shown contoured at 1σ.

A water molecule supports the active-site arrangement, interacting with Asp26, Thr71 and His113, and is present even in the absence of substrate. This is thought to play a pivotal role in the organization of the substrate complex and of the hydrogen-bond network (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]).

The pyrophosphate group of TPP is anchored to the protein by a Mg2+ ion. It forms an octahedral coordination sphere with the two O atoms on the diphosphate group of the TPP, the side-chain O atoms of Asp435 and Asn462, the main-chain O atom of Gly464 and a water molecule.

The active sites appear to be connected by a water tunnel (Fig. 4[link]). This has been noted in PDCs and other TPP-binding enzymes (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]; Frank et al., 2004[Frank, R. A., Titman, C. M., Pratap, J. V., Luisi, B. F. & Perham, R. N. (2004). Science, 306, 872-876.]). Pei et al. (2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]) suggested that it may play a role as a form of communication system between the active sites, perhaps as a proton-relay system. PDB entry 5euj shows the same pattern of water molecules as PDB entry 2wva. Similarly, the residues lining the tunnel seem to be well conserved and include Glu49, Asn48, Leu50 and His409.

[Figure 4]
Figure 4
Model of the water tunnel connecting the two active sites in the ZpPDC dimer. Water molecules are shown as blue spheres and magnesium ions as dark grey spheres. Residues and the TPP from one monomer are shown as cyan (both C atoms and cartoon), while the other monomer in the dimer is coloured green.

A comparison of apo and holo ZmPDC structures by Pei et al. (2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]) revealed that TPP binding induces a conformational change involving the loop and the adjacent α-helix between Asn467 and Tyr481 (Asn462 and Tyr476 in PDB entry 5euj). This region is structured in the apoenzyme and thus requires major conformational changes to accommodate TPP binding (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]). Similar changes would presumably occur in ZpPDC as this region is structurally highly conserved in bacterial PDCs.

3.4. Substrate binding and the catalysis mechanism

As mentioned above, no pyruvate was found in the crystal structure presented here. However, EDO was bound in the active site of some chains, and aligns very well with the positioning of pyruvate when superposed with chain F of PDB entry 2wva (Fig. 3[link]). This allowed the observation of inter­actions that might be made with pyruvate and comparison with those reported by Pei et al. (2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]) and Dobritzsch et al. (1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]).

Glu468 and Tyr289 from one monomer and Asp26, His112 and His113 from a second monomer interact with EDO through an extensive hydrogen-bond network.

Glu468 is very likely to play a key role in catalysis and is thought to be the proton acceptor from the 4′-NH2 group of TPP, thus deprotonating C2 to form the active ylid (Kern et al., 1997[Kern, D., Kern, G., Neef, H., Tittmann, K., Killenberg-Jabs, M., Wikner, C., Schneider, G. & Hübner, G. (1997). Science, 275, 67-70.]; Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]). It is further thought to form a stabilizing hydrogen-bond interaction with the dianion formed after the nucleophilic attack of the thiazolium-ring carbanion on pyruvate (Dobritzsch et al., 1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]). In the lactyl-TPP intermediate, the five-membered ring is positively charged, facilitating a reverse proton transfer from Glu468 to 4′-N. The now negatively charged Glu468 destabilizes the adjacent carboxylate group on the pyruvate and thus facilitates subsequent decarboxylation (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]). Tittmann et al. (2003[Tittmann, K., Golbik, R., Uhlemann, K., Khailova, L., Schneider, G., Patel, M., Jordan, F., Chipman, D. M., Duggleby, R. G. & Hübner, G. (2003). Biochemistry, 42, 7885-7891.]) and Meyer et al. (2010[Meyer, D., Neumann, P., Parthier, C., Friedemann, R., Nemeria, N., Jordan, F. & Tittmann, K. (2010). Biochemistry, 49, 8197-8212.]) investigated the role of this residue further, and using a variety of mutants found it to be crucial in substrate binding and catalysis. His112 may not be directly involved in catalysis, but plays an important role in maintaining the active-site environment, in particular in retaining His113 uncharged. This in turn is essential to allow proton abstraction from C2 in the first step of catalysis (Dobritzsch et al., 1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]). Furthermore, His112 is likely to be involved in holding the carboxylate group of Asp26 in the correct state and position, supported by Tyr289 (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]). Asp26 may also be involved in acetaldehyde release (Pei et al., 2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]). His113 interacts with O3 of pyruvate and N4′ of TPP (Dobritzsch et al., 1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]).

Dobritzsch et al. (1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]) remarked that large conformational changes upon substrate binding are unlikely owing to the extensive interface regions. Instead, it is thought that the C-terminal helix swings out of the way to allow access to the active site and closes upon substrate binding to create a hydrophobic active-site environment. This helix is also exposed in PDB entry 5euj, so it is likely that a similar mechanism applies here.

In summary, we present the crystal structure of Z. palmae PDC and a brief functional and structural comparison to known bacterial PDCs. They are structurally well conserved, which may allow the in-depth studies carried out on ZmPDC of the mechanism of folding as presented by Pohl et al. (1994[Pohl, M., Grötzinger, J., Wollmer, A. & Kula, M. R. (1994). Eur. J. Biochem. 224, 651-661.]) and the mechanism of catalysis as described by Dobritzsch et al. (1998[Dobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196-20204.]), Pei et al. (2010[Pei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727-1736.]) and Meyer et al. (2010[Meyer, D., Neumann, P., Parthier, C., Friedemann, R., Nemeria, N., Jordan, F. & Tittmann, K. (2010). Biochemistry, 49, 8197-8212.]) to be applied to ZpPDC. Structural analysis suggests that the different thermostability and thermoactivity displayed by these PDCs may be correlated with increased oligomeric interface and salt bridges, as has been seen in many other protein families (Sterner & Liebl, 2001[Sterner, R. & Liebl, W. (2001). Crit. Rev. Biochem. Mol. Biol. 36, 39-106.]). We hereby add to the structural knowledge of bacterial PDCs, generating information that has the potential to be very useful in design approaches for enzyme-engineering and biotechnological applications.

Supporting information


Acknowledgements

This work is based on a collaboration between the University of Bath, England and the University of Waikato, New Zealand supported by a Microbiology Society research visit grant (RVG14-10). LB thanks the Biotechnology and Biological Sciences Research Council for a CASE studentship with TMO Renewables Ltd.

References

First citationBarbosa, M. de F. S. & Ingram, L. O. (1994). Curr. Microbiol. 28, 279–282.  CrossRef CAS Google Scholar
First citationBattye, T. G. G., Kontogiannis, L., Johnson, O., Powell, H. R. & Leslie, A. G. W. (2011). Acta Cryst. D67, 271–281.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationBringer-Meyer, S., Schimz, K.-L. & Sahm, H. (1986). Arch. Microbiol. 146, 105–110.  CAS Google Scholar
First citationChen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12–21.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationDobritzsch, D., König, S., Schneider, G. & Lu, G. (1998). J. Biol. Chem. 273, 20196–20204.  Web of Science CrossRef CAS PubMed Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEvans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204–1214.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFrank, R. A., Titman, C. M., Pratap, J. V., Luisi, B. F. & Perham, R. N. (2004). Science, 306, 872–876.  CrossRef PubMed CAS Google Scholar
First citationGocke, D., Graf, T., Brosi, H., Frindi-Wosch, I., Walter, L., Müller, M. & Pohl, M. (2009). J. Mol. Catal. B Enzym. 61, 30–35.  CrossRef CAS Google Scholar
First citationHaba, R. R. de la, Arahal, D. R., Márquez, M. C. & Ventosa, A. (2010). Int. J. Syst. Evol. Microbiol. 60, 737–748.  PubMed Google Scholar
First citationHorn, S. J., Aasen, A. M. & Østgaard, K. (2000). J. Ind. Microbiol. Biotechnol. 24, 51–57.  CrossRef CAS Google Scholar
First citationIngram, L. O., Aldrich, H. C., Borges, A. C. C., Causey, T. B., Martinez, A., Morales, F., Saleh, A., Underwood, S. A., Yomano, L. P., York, S. W., Zaldivar, J. & Zhou, S. (1999). Biotechnol. Prog. 15, 855–866.  CrossRef PubMed CAS Google Scholar
First citationIngram, L. O., Conway, T., Clark, D. P., Sewell, G. W. & Preston, J. F. (1987). Appl. Environ. Microbiol. 53, 2420–2425.  CAS PubMed Google Scholar
First citationKern, D., Kern, G., Neef, H., Tittmann, K., Killenberg-Jabs, M., Wikner, C., Schneider, G. & Hübner, G. (1997). Science, 275, 67–70.  CrossRef CAS PubMed Web of Science Google Scholar
First citationLiu, S., Dien, B. S. & Cotta, M. A. (2005). Curr. Microbiol. 50, 324–328.  CrossRef PubMed CAS Google Scholar
First citationLong, F., Vagin, A. A., Young, P. & Murshudov, G. N. (2008). Acta Cryst. D64, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationLowe, S. E. & Zeikus, J. G. (1992). J. Gen. Microbiol. 138, 803–807.  CrossRef PubMed CAS Google Scholar
First citationMeyer, D., Neumann, P., Parthier, C., Friedemann, R., Nemeria, N., Jordan, F. & Tittmann, K. (2010). Biochemistry, 49, 8197–8212.  CrossRef CAS PubMed Google Scholar
First citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationOkamoto, T., Taguchi, H., Nakamura, K., Ikenaga, H., Kuraishi, H. & Yamasato, K. (1993). Arch. Microbiol. 160, 333–337.  CrossRef CAS PubMed Google Scholar
First citationPei, J., Erixon, K. M., Luisi, B. F. & Leeper, F. J. (2010). Biochemistry, 49, 1727–1736.  CrossRef CAS PubMed Google Scholar
First citationPei, J., Kim, B.-H. & Grishin, N. V. (2008). Nucleic Acids Res. 36, 2295–2300.  Web of Science CrossRef PubMed CAS Google Scholar
First citationPohl, M., Grötzinger, J., Wollmer, A. & Kula, M. R. (1994). Eur. J. Biochem. 224, 651–661.  CrossRef CAS PubMed Google Scholar
First citationPotterton, E., Briggs, P., Turkenburg, M. & Dodson, E. (2003). Acta Cryst. D59, 1131–1137.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationRaj, K. C., Talarico, L. A., Ingram, L. O. & Maupin-Furlow, J. A. (2002). Appl. Environ. Microbiol. 68, 2869–2876.  CrossRef PubMed CAS Google Scholar
First citationSiegert, P., McLeish, M. J., Baumann, M., Iding, H., Kneen, M. M., Kenyon, G. L. & Pohl, M. (2005). Protein Eng. Des. Sel. 18, 345–357.  Web of Science CrossRef PubMed CAS Google Scholar
First citationSterner, R. & Liebl, W. (2001). Crit. Rev. Biochem. Mol. Biol. 36, 39–106.  Web of Science CrossRef PubMed CAS Google Scholar
First citationTaylor, M. P., Esteban, C. D. & Leak, D. J. (2008). Plasmid, 60, 45–52.  CrossRef PubMed CAS Google Scholar
First citationThompson, A. H., Studholme, D. J., Green, E. M. & Leak, D. J. (2008). Biotechnol. Lett. 30, 1359–1365.  CrossRef PubMed CAS Google Scholar
First citationTittmann, K., Golbik, R., Uhlemann, K., Khailova, L., Schneider, G., Patel, M., Jordan, F., Chipman, D. M., Duggleby, R. G. & Hübner, G. (2003). Biochemistry, 42, 7885–7891.  Web of Science CrossRef PubMed CAS Google Scholar
First citationWechsler, C., Meyer, D., Loschonsky, S., Funk, L. M., Neumann, P., Ficner, R., Brodhun, F., Müller, M. & Tittmann, K. (2015). Chembiochem, 16, 2580–2584.  CrossRef CAS PubMed Google Scholar
First citationWinn, M. D. et al. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationZyl, L. J. van, Schubert, W. D., Tuffin, M. I. & Cowan, D. A. (2014). BMC Struct. Biol. 14, 21.  Google Scholar
First citationZyl, L. J. van, Taylor, M. P., Eley, K., Tuffin, M. & Cowan, D. A. (2014). Appl. Microbiol. Biotechnol. 98, 1247–1259.  PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds