research papers\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983

An epoxide hydrolase from endophytic Streptomyces shows unique structural features and wide biocatalytic activity

aDepartment of Organic Chemistry, Institute of Chemistry, University of Campinas, Campinas-SP 3083-970, Brazil, bDepartment of Microbiology, Institute of Biomedical Science, University of São Paulo, Avenida Prof. Lineu Prestes 1374, São Paulo-SP 05508-000, Brazil, cDepartment of Biology, IBILCE – University of State of São Paulo, São José do Rio Preto-SP 15054-000, Brazil, and dDepartment of Chemistry, University of Warwick, Warwick CV4 7AL, United Kingdom
*Correspondence e-mail: [email protected], [email protected],[email protected]

Edited by M. Rudolph, F. Hoffmann-La Roche Ltd, Switzerland (Received 18 April 2020; accepted 28 July 2020; online 17 August 2020)

The genus Streptomyces is characterized by the production of a wide variety of secondary metabolites with remarkable biological activities and broad antibiotic capabilities. The presence of an unprecedented number of genes encoding hydrolytic enzymes with industrial appeal such as epoxide hydrolases (EHs) reveals its resourceful microscopic machinery. The whole-genome sequence of Streptomyces sp. CBMAI 2042, an endophytic actinobacterium isolated from Citrus sinensis branches, was explored by genome mining, and a putative α/β-epoxide hydrolase named B1EPH2 and encoded by 344 amino acids was selected for functional and structural studies. The crystal structure of B1EPH2 was obtained at a resolution of 2.2 Å and it was found to have a similar fold to other EHs, despite its hexameric quaternary structure, which contrasts with previously solved dimeric and monomeric EH structures. While B1EPH2 has a high sequence similarity to EHB from Mycobacterium tuberculosis, its cavity is similar to that of human EH. A group of 12 aromatic and aliphatic racemic epoxides were assayed to determine the activity of B1EPH2; remarkably, this enzyme was able to hydrolyse all the epoxides to the respective 1,2-diols, indicating a wide-range substrate scope acceptance. Moreover, the (R)- and (S)-enantiomers of styrene oxide, epichlorohydrin and 1,2-epoxybutane were used to monitor enantiopreference. Taken together, the functional and structural analyses indicate that this enzyme is an attractive biocatalyst for future biotechnological applications.

1. Introduction

Epoxides and the associated enantiopure epoxides and diols are high-value compounds (de Vries & Janssen, 2003[Vries, E. J. de & Janssen, D. B. (2003). Curr. Opin. Biotechnol. 14, 414-420.]; Archelas & Furstoss, 2001[Archelas, A. & Furstoss, R. (2001). Curr. Opin. Chem. Biol. 5, 112-119.]; Kotik et al., 2010[Kotik, M., Štěpánek, V., Grulich, M., Kyslík, P. & Archelas, A. (2010). J. Mol. Catal. B Enzym. 65, 41-48.]) that are in demand as fine chemicals by the pharmaceutical, biotechnological and chemical industries owing to their applicability as precursors and intermediates in the synthesis of a large number of organic compounds (Saini & Sareen, 2017[Saini, P. & Sareen, D. (2017). Mol. Biotechnol. 59, 98-116.]; Fretland & Omiecinski, 2000[Fretland, A. J. & Omiecinski, C. J. (2000). Chem. Biol. Interact. 129, 41-59.]; Savle et al., 1998[Savle, P. S., Lamoreaux, M. J., Berry, J. F. & Gandour, R. D. (1998). Tetrahedron Asymmetry, 9, 1843-1846.]; Archelas & Furstoss, 2001[Archelas, A. & Furstoss, R. (2001). Curr. Opin. Chem. Biol. 5, 112-119.]). Electrophilic functional groups such as epoxides are widespread in nature and are essential for the biological activity of natural products targeting nucleophilic centers in macromolecules in the living world.

Soluble epoxide hydrolases (EHs) are a class of enzymes that can promote the asymmetric hydrolysis of epoxides to their respective 1,2-diols and have emerged as versatile biocatalysts for the production of chiral intermediates (Saini & Sareen, 2017[Saini, P. & Sareen, D. (2017). Mol. Biotechnol. 59, 98-116.], 2019[Saini, P. & Sareen, D. (2019). Nanoscience and Biotechnology for Environmental Applications, edited by K. Gothandam, S. Ranjan, N. Dasgupta & E. Lichtfouse, pp. 141-198. Cham: Springer.]; Pedragosa-Moreau et al., 1995[Pedragosa-Moreau, S., Archelas, A. & Furstoss, R. (1995). Bull. Soc. Chim. Fr. 132, 769-800.]; Faber, 2011[Faber, K. (2011). Biotransformations in Organic Chemistry. Berlin: Springer-Verlag.]; Archelas & Furstoss, 2001[Archelas, A. & Furstoss, R. (2001). Curr. Opin. Chem. Biol. 5, 112-119.]). Microbial EHs have been widely used as biocatalysts in diverse organic synthesis routes owing to their stability, broad substrate acceptance and advantages of chemoselectivity, regioselectivity and enantio­selectivity. Furthermore, EHs represent a green alternative to the classical asymmetric synthesis of epoxides and diols (Hammock et al., 1997[Hammock, B. D., Grant, D. F. & Storms, D. H. (1997). Comprehensive Toxicology, Vol. 3, edited by F. P. Guengerich, pp. 283-305. Oxford: Pergamon.]; Morisseau & Hammock, 2005[Morisseau, C. & Hammock, B. D. (2005). Annu. Rev. Pharmacol. Toxicol. 45, 311-333.]; Horsman et al., 2013[Horsman, G. P., Lechner, A., Ohnishi, Y., Moore, B. S. & Shen, B. (2013). Biochemistry, 52, 5217-5224.]). For instance, EHs are suitable for chemoenzymatic approaches to prepare (S)-β-amino alcohols through an epoxide hydrolase/alcohol dehydrogenase/transaminase cascade (Zhang et al., 2019[Zhang, J.-D., Yang, X.-X., Jia, Q., Zhao, J.-W., Gao, L.-L., Gao, W.-C., Chang, H.-H., Wei, W.-L. & Xu, J.-H. (2019). Catal. Sci. Technol. 9, 70-74.]) or to prepare (2R,5R)-linalool oxide using various EHs and a Tsuji–Trost cyclo­etherification (van Lint et al., 2019[Lint, M. J. van, Gümüs, A., Ruijter, E., Faber, K., Orru, R. V. A. & Hall, M. (2019). Adv. Synth. Catal. 361, 813-825.]).

EHs are ubiquitous in nature and play various roles in the physiologies of all organisms, including the detoxification of xenobiotics (Decker et al., 2009[Decker, M., Arand, M. & Cronin, A. (2009). Arch. Toxicol. 83, 297-318.]), regulation of blood pressure (Sinal et al., 2000[Sinal, C. J., Miyata, M., Tohkin, M., Nagata, K., Bend, J. R. & Gonzalez, F. J. (2000). J. Biol. Chem. 275, 40504-40510.]) and inflammatory responses (Morisseau & Hammock, 2005[Morisseau, C. & Hammock, B. D. (2005). Annu. Rev. Pharmacol. Toxicol. 45, 311-333.]). Epoxide hydrolases are classified into two different groups based on their folds: soluble α/β-hydrolases (EC 3.3.2.10), which are the most diverse and the most studied and are already used for transformations in industry (Pedragosa-Moreau et al., 1996[Pedragosa-Moreau, S., Morisseau, C., Zylber, J., Archelas, A., Baratti, J. & Furstoss, R. (1996). J. Org. Chem. 61, 7402-7407.]), and limonene epoxide hydrolases (LEHs; EC 3.3.2.8), which differ from other EHs in their fold and in their one-step catalytic mechanism (Arand et al., 2003[Arand, M., Hallberg, B. M., Zou, J., Bergfors, T., Oesch, F., van der Werf, M. J., de Bont, J. A., Jones, T. A. & Mowbray, S. L. (2003). EMBO J. 22, 2583-2592. ]). Enzymes similar to LEHs are known to be involved in the biosynthesis of several ionophore polyethers (Dutton et al., 1995[Dutton, C. J., Banks, B. J. & Cooper, C. B. (1995). Nat. Prod. Rep. 12, 165.]).

Structurally, the EHs that belong to the α/β-hydrolases consist of two dissimilar N- and C-terminal domains. The C-terminal domain (hydrolase domain) is well conserved and is composed of an eight-stranded β-sheet flanked by α-helices and by the N-terminal domain (cap domain), which is less conserved and is generally formed by a bundle of α-helices (Nardini et al., 2001[Nardini, M., Rink, R., Janssen, D. B. & Dijkstra, B. W. (2001). J. Mol. Catal. B Enzym. 11, 1035-1042.]; Argiriadi et al., 1999[Argiriadi, M. A., Morisseau, C., Hammock, B. D. & Christianson, D. W. (1999). Proc. Natl Acad. Sci. USA, 96, 10637-10642.]). The EH active site is usually located in a groove between the hydrolase and cap domains and has a catalytic triad formed by two acidic residues and a nucleophile, with a histidine playing the role of a general base. Two tyrosines from the cap domain are involved in the oxyanion-binding site for epoxide substrates (Nardini et al., 1999[Nardini, M., Ridder, I. S., Rozeboom, H. J., Kalk, K. H., Rink, R., Janssen, D. B. & Dijkstra, B. W. (1999). J. Biol. Chem. 274, 14579-14586.], 2001[Nardini, M., Rink, R., Janssen, D. B. & Dijkstra, B. W. (2001). J. Mol. Catal. B Enzym. 11, 1035-1042.]; Zou et al., 2000[Zou, J., Hallberg, B. M., Bergfors, T., Oesch, F., Arand, M., Mowbray, S. L. & Jones, T. A. (2000). Structure, 8, 111-122.]; Argiriadi et al., 1999[Argiriadi, M. A., Morisseau, C., Hammock, B. D. & Christianson, D. W. (1999). Proc. Natl Acad. Sci. USA, 96, 10637-10642.]). Only a few EHs have a characterized three-dimensional structure, which supports the need for further structural studies in order to understand the basis for enantioselectivity and improved catalytic efficiency. However, most of the available EH structures are from fungi and there is a lack of structures of Streptomyces EHs, which differ from those involved in the biosynthesis of particular bioactive compounds (such as those similar to LEH). Importantly, the identification of microbial EHs using alternative screening strategies such as genome mining is convenient in order to overcome these limitations, and the expansion of publicly available genome databases has revealed these bacterial groups to be prolific producers of hydrolytic enzymes (Davids et al., 2013[Davids, T., Schmidt, M., Böttcher, D. & Bornscheuer, U. T. (2013). Curr. Opin. Chem. Biol. 17, 215-220.]; Guérard-Hélaine et al., 2015[Guérard-Hélaine, C., de Berardinis, V., Besnard-Gonnet, M., Darii, E., Debacker, M., Debard, A., Fernandes, C., Hélaine, V., Mariage, A., Pellouin, V., Perret, A., Petit, J.., Sancelme, M., Lemaire, M. & Salanoubat, M. (2015). ChemCatChem, 7, 1871-1879.]; Saini & Sareen, 2019[Saini, P. & Sareen, D. (2019). Nanoscience and Biotechnology for Environmental Applications, edited by K. Gothandam, S. Ranjan, N. Dasgupta & E. Lichtfouse, pp. 141-198. Cham: Springer.]).

Our recent genome-mining studies revealed Streptomyces sp. CBMAI 2042, an endophytic strain isolated from Citrus sinensis branches, to be a promising source of secondary metabolites (de Oliveira, Sigrist et al., 2019[Oliveira, L. G. de, Sigrist, R., Paulo, B. S. & Samborskyy, M. (2019). Microbiol. Resour. Announc. 8, e01426-18.]; Paulo, Sigrist, Angolini & De Oliveira, 2019[Paulo, B. S., Sigrist, R., Angolini, C. F. F. & De Oliveira, L. G. (2019). ChemistrySelect, 4, 7785-7790.]; Sigrist, Paulo et al., 2020[Sigrist, R., Paulo, B. S., Angolini, C. F. F. & de Oliveira, L. G. (2020). J. Vis. Exp., e60825.]; Sigrist, Luhavaya et al., 2020[Sigrist, R., Luhavaya, H., McKinnie, S. M. K., Ferreira da Silva, A., Jurberg, I. D., Moore, B. S. & de Oliveira, L. G. (2020). ACS Chem. Biol. 15, 1067-1077.]; Paulo, Sigrist, Angolini, Eberlin et al., 2019[Paulo, B. S., Sigrist, R., Angolini, C. F. F., Eberlin, M. N. & De Oliveira, L. G. (2019). J. Braz. Chem. Soc. 30, 673-679.]). Additionally, biotransformation experiments using whole cells revealed the capability of the strain to promote epoxide hydrolysis (unpublished results). This actinobacterium was completely sequenced using Illumina technology (GenBank RCOL00000000; de Oliveira et al., 2019[Oliveira, G. S. de, Adriani, P. P., Ribeiro, J. A., Morisseau, C., Hammock, B. D., Dias, M. V. B. & Chambergo, F. S. (2019). Int. J. Biol. Macromol. 129, 653-658.]); two EHs were predicted from the draft genome and were named B1EPH1 and B1EPH2. Here, we describe functional and structural studies of B1EPH2, which provide novel insights into the oligomeric state of this class of proteins and also their promiscuity for alternative substrates.

2. Materials and methods

2.1. Cloning, expression and purification of B1EPH2

The b1eph2 ORF was amplified from Streptomyces sp. CBMAI 2042 genomic DNA by PCR. B1EPH2 was annotated from whole-genome sequencing of Streptomyces sp. CBMAI 2042 (RCOL01000001.1:3543330..3544202; Sequence ID RLV67613.1) as a putative α/β-epoxide hydrolase encoded by 344 amino acids (Tormet-Gonzalez & de Oliveira, 2018a[Tormet-Gonzalez, G. D. & de Oliveira, L. G. (2018a). Brazilian Patent BR102016026341-7A.],b[Tormet-Gonzalez, G. D. & de Oliveira, L. G. (2018b). World Patent WO2018085906A1.]). The resulting strain, Escherichia coli DSM 32387, was deposited in the Leibniz Institute DSMZ (German Collection of Microorganisms and Cell Cultures). The encoded ORF was cloned into pET-29b(+) and the resulting plasmid pGTEPH2 was successfully transformed into E. coli BL21(DE3) cells, which were grown in LB medium containing 50 µg ml−1 kanamycin. Further data on cloning are given in Table 1[link]. Expression of the b1eph2 gene was induced by 0.4 mM IPTG for 16 h at 18°C. The cells were harvested by centrifugation and disrupted by sonication. The soluble and insoluble fractions were separated by centrifugation at 4°C. B1EPH2 was purified from the soluble fraction using an IMAC Nickel HiTrap column, pre-equilibrated with 50 mM HEPES pH 8.0, 300 mM NaCl, 10% glycerol (buffer A), coupled to an ÄKTA purifier system (GE) using a linear gradient of buffer A plus 500 mM imidazole (buffer B). A further step of gel filtration was performed using 50 mM HEPES pH 8.0, 300 mM NaCl (buffer C). The sample was concentrated to 15 mg ml−1, flash-frozen in liquid nitrogen and stored at −80°C until use.

Table 1
Macromolecule-production information

Source organism Streptomyces sp. CBMAI 2042
Forward primer GACCATATGACGACGACCCCACCACC
Reverse primer CTCGAATTCCGCAGCCCGTCCAGCCAC
Expression vector pET-29b(+)
Expression host E. coli BL21(DE3)
Complete amino-acid sequence of the construct produced VPQPPTDDPTTPAEKGAVHRLVDTPGGRIHLVEQGTGPLVLLVHGFPESWYSWRHQLPALAAAGYRAAAIDVRGYGRSAKPAATDAYRMLAHVADNTAVVHALGEETATVVGHDWGSPIAANSALLRPDVFTAVGLLSVPYAPRGEHRPTDGFARIGGDEEFYVSYFQAPGRAEAEIERDVRGWLAGFYTGLTGGALTPEEHGRLFFVPPGAHLADRFPTGPLPAWLTEADLDVYSGEFERSGLTGALNRYRNVDRDWEDLAAWHGAPITQPSLFIGGALDASTTWMADALDAYPATLPGLSAAHILEGCGHWIQQERPDEVNRLLTQWLDGLR

2.2. Activity and enantiopreference assays

The activity of the enzyme as epoxide hydrolase was assayed using the adrenaline test (Fluxá et al., 2008[Fluxá, V. S., Wahler, D. & Reymond, J.-L. (2008). Nat. Protoc. 3, 1270-1277.]) against 12 epoxide substrates dissolved in dimethyl sulfoxide (DMSO). The adrenaline test is widely used to allow the quantification of periodate-sensitive hydrolysis reactions by back-titration of the oxidant with adrenaline to produce adrenochrome as a detectable red product at λmax = 490 nm. The test was prepared in 96-well microplates using enzyme concentrations between 1 and 25 µg ml−1 in sodium phosphate buffer pH 6.0. Negative controls relating to the same reaction without enzyme (to reflect spontaneous epoxide hydrolysis under the reaction conditions) or substrate and a positive control (1,2-cyclohexanodiol as substrate) were included in each microplate. Negative control values were subtracted from enzyme assay values to estimate the conversion (0–100% compared with 1,2-cyclohexanediol). The experiments were conducted in triplicate.

In order to determine the enantiopreference of B1EPH2, pure (R)- and (S)-enantiomers of 2-phenyloxirane [(R)-styrene oxide, (R)-(11), and (S)-(+)-styrene oxide, (S)-(11)], (R)- and (S)-2-(chloromethyl)oxirane [(R)-(−)-epichlorohydrin, (R)-(14), and (S)-(+)-epichlorohydrin, (S)-(14)] and (R)- and (S)-1,2-ethyloxirane [(R)-(+)-1,2-epoxybutane, (R)-(15), and (S)-(−)-1,2-epoxybutane, (S)-(15)] were assayed using the adrenaline test. The reaction was carried out with 90 µg ml−1 B1EPH2 for both enantiomers of styrene oxide and with 1250 µg ml−1 B1EPH2 for both enantiomers of epichlorohydrin and 1,2-epoxybutane in sodium phosphate buffer pH 6.0 at 25°C for 10 min. The final concentration of substrate in the reactions was 50 mM for both enantiomers of styrene oxide and 100 mM for both enantiomers of epichlorohydrin and 1,2-epoxybutane. All substrates were diluted in DMSO. The estimated E value using pure enantiomers was measured in individual wells of the same microtiter plate, setting the endpoint as 10 min of reaction. The adrenochrome absorption was correlated indirectly to 1,2-diol formation using a calibration curve (sodium periodate consumption versus adrenochrome formation). Calculation of E from the initial enantiomeric reaction rates of both enantiomerically pure epoxides was based on the apparent rate V, where E is the enantiomeric ratio Vfast enantiomer/Vslower enantiomer (Badalassi et al., 2000[Badalassi, F., Wahler, D., Klein, G., Crotti, P. & Reymond, J. (2000). Angew. Chem. Int. Ed. 39, 4067-4070.]).

2.3. Crystallization, X-ray data collection, structure determination, refinement and analysis

B1EPH2 at a concentration of 10 mg ml−1 was initially subjected to approximately 500 different crystallization conditions. The drops were prepared using a HoneyBee 963 (Digilab Global) crystallization robot using 0.3 µl protein solution and 0.3 µl precipitant solution in 96-well sitting-drop plates with 40 µl well solution (LNBio-CNPEM, Campinas, Brazil). The plates were maintained in a Rock Imager 1000 (Formulatrix) equipped with UV–Vis light at 18°C for five months. After obtaining the initial crystal hits, the best conditions were manually optimized using the hanging-drop vapor-diffusion method in Linbro plates, and diffracting crystals were obtained in a condition consisting of 0.1 M sodium cacodylate pH 6.5, 1 M trisodium citrate using protein at a concentration of 12.5 mg ml−1 after 2–3 days. Further data on the crystallization methods and cryoprotection protocol are given in Table 2[link]. Data were collected from B1EPH2 crystals on MX2 at Laboratório Nacional de Luz Síncrotron (LNLS), Campinas, Brazil. The X-ray diffraction data were processed using XDS (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]) and scaled using AIMLESS (Evans & Murshudov, 2013[Evans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204-1214.]) from the CCP4 suite (Winn et al., 2011[Winn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235-242.]). The number of molecules in the asymmetric unit was estimated by MATTHEWS_COEF also from the CCP4 suite. The B1EPH2 structure was solved by molecular replacement using Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) from the CCP4 suite and the structure of epoxide hydrolase B from Mycobacterium tuberculosis (PDB entry 2zjf; James et al., 2008[James, M. N. G., Biswal, B. K., Cherney, M. M., Garen, C., Niu, C., Hammock, B. D., Morisseau, C. & Garen, G. (2008). J. Mol. Biol. 381, 897-912.]) as a search model. The refinement of the B1EPH2 structure was carried out using phenix.refine (Afonine et al., 2012[Afonine, P. V., Grosse-Kunstleve, R. W., Echols, N., Headd, J. J., Moriarty, N. W., Mustyakimov, M., Terwilliger, T. C., Urzhumtsev, A., Zwart, P. H. & Adams, P. D. (2012). Acta Cryst. D68, 352-367.]) from the Phenix suite (Liebschner et al., 2019[Liebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861-877.]). For enhancement, we used NCS restraints and one TLS group. Refinement in real space and visualization were performed using Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). The stereochemical quality was ascertained by MolProbity (Chen et al., 2010[Chen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12-21.]) and figures were prepared using PyMOL version 1.8 (Schrödinger).

Table 2
Crystallization conditions for B1EPH2 and cryoprotection protocol

Method Hanging-drop vapor diffusion
Plate type Linbro plates
Temperature (K) 293
Protein concentration (mg ml−1) 12.5
Buffer composition of protein solution 50 mM HEPES pH 8.0, 300 mM NaCl
Composition of reservoir solution 0.1 M sodium cacodylate pH 6.5, 1 M trisodium citrate
Volume and ratio of drop 1:1
Volume of reservoir (ml) 400
Cryoprotectant 30% ethylene glycol, 70% reservoir solution

3. Results and discussion

3.1. Activity and enantiopreference of B1EPH2

The adrenaline assay has been widely used to study the activities of EHs (Fluxá et al., 2008[Fluxá, V. S., Wahler, D. & Reymond, J.-L. (2008). Nat. Protoc. 3, 1270-1277.]). In this colorimetric test, compounds that are sensitive to sodium periodate such as the 1,2-diols formed by the enzymatic hydrolysis of epoxides, are chemically oxidized. The remaining periodate is retro-titrated with L-epinephrine, turning the colorless solution red by the formation of adrenochrome, which can be monitored at 490 nm in a miniaturized assay. To test the activity of B1EPH2 as epoxide hydrolase, 12 racemic epoxides with a diverse pattern of substituents were selected (Fig. 1[link]). Remarkably, the enzyme showed activity from 20 µg ml−1 and was able to hydrolyse all assayed substrates. Additionally, it was recognized that the enzymatic activity increases according to the enzyme concentration, as expected. The relative conversion of epoxides to the corresponding 1,2-diols was compared with that of the positive control 1,2-cyclohexanediol (100% conversion). Under the assay conditions, the highest activities were observed for styrene oxide (11; 33% conversion), 1,2-epoxyoctane (4; 24% conversion) and phenyl glycidyl ether (3; 25% conversion). In general, the remaining substrates tested were hydrolysed to similar extents by the enzyme. The lowest activities measured were for 1,4-cyclohexene diglycidyl oxide (12) and cyclohexene oxide (13) (with 15% and 10% conversion, respectively; Fig. 1[link]).

[Figure 1]
Figure 1
Relative activity of B1EPH2 against a broad range of substrates. The enzyme activity was measured using the adrenaline test protocol as described by Fluxá et al. (2008[Fluxá, V. S., Wahler, D. & Reymond, J.-L. (2008). Nat. Protoc. 3, 1270-1277.]).

In order to identify the enantiopreference of B1EPH2, the (R)- and (S)-enantiomers of 2-phenyloxirane (styrene oxide; 11), 2-(chloromethyl)oxirane (epichlorohydrin; 14) and 1,2-ethyloxirane (epoxybutane; 15) were also evaluated using the adrenaline assay. This experiment showed that the enzyme is slightly more selective for the hydrolysis of (R)-(+)-styrene oxide (estimated E = 2.9; Table 3[link]) than the (S)-enantiomer (Fig. 2[link]a). B1EPH2 is also enantioselective for epichlorohydrin and 1,2-epoxybutane, and preferentially hydrolyses (R)-(−)-epichlorohydrin (Fig. 2[link]b; estimated E = 1.5; Table 3[link]) and (S)-(−)-1,2-epoxybutane (Fig. 2[link]c; estimated E = 2.0; Table 3[link]). These results are similar to those observed for the EH from Phanerochaete chrysosporium (Li et al., 2009[Li, N., Zhang, Y. & Feng, H. (2009). Acta Biochim. Biophys. Sin. (Shanghai), 41, 638-647.]), which in contrast has a greater preference for the hydrolysis of (R)-(+)-styrene oxide but a very limited selectivity for the (R)- or (S)-enantiomers of epichlorohydrin or 1,2-epoxybutane (E values were not estimated). These assays indicate that B1EPH2 can hydrolyse both (R)- and (S)-enantiomers to different extents, with a difference of between 1.5-fold and threefold for specific enantiomers according to Fig. 2[link]. However, the estimated enantiomeric ratio (E) observed for all compounds is modest. The main difference between experiments using separate enantiomerically pure probes (estimated E values) and the true E values is the absence of enantiomeric competition for the same enzymatically active site, which can lead to estimated E values that can be far from the true values (Chen et al., 1982[Chen, C. S., Fujimoto, Y., Girdaukas, G. & Sih, C. J. (1982). J. Am. Chem. Soc. 104, 7294-7299.]; Janes & Kazlauskas, 1997[Janes, L. E. & Kazlauskas, R. J. (1997). J. Org. Chem. 62, 4560-4561.]; Mantovani et al., 2008[Mantovani, S. M., de Oliveira, L. G. & Marsaioli, A. J. (2008). J. Mol. Catal. B Enzym. 52-53, 173-177.]). The estimated E values were calculated based on the apparent rate (V) of (R)- and (S)-1,2-diol formation after 10 min of reaction (Table 3[link]). Compared with the enzyme preferences given above, it is possible to suggest that the nucleophilic attack by water occurs in the less hindered position, as in other retaining enzymes, and therefore the stereochemistry of the substrates drives the enantioselectivity. For styrene oxide, the preference for the opposite chiral isomer could be owing to better positioning of the aromatic substituent inside the active-site pocket. However, further investigation, including site-directed mutagenesis, is necessary to determine the basis for the stereoselectivity of this enzyme.

Table 3
Apparent reaction rates (V) of 1,2-diol formation during the hydrolysis of epoxides 11, 14 and 15 promoted by B1EPH2

  V(R) (mmol min−1) V(S) (mmol min−1) Estimated E†
1-Phenylethane-1,2-diol 0.073 (±0.011) 0.025 (±0.008) 2.9
3-Chloropropane-1,2-diol 0.373 (±0.020) 0.243 (±0.003) 1.5
Butane-1,2-diol 0.188 (±0.0006) 0.385 (±0.002) 2.0
†E is the enantiomeric ratio between V(R) and V(S).
[Figure 2]
Figure 2
Preferential hydrolysis of enantiomeric epoxides by B1EPH2. The assay was performed with the (R)- and (S)-enantiomers of styrene oxide, epichlorohydrin and 1,2-epoxybutane using B1EPH2 as a biocatalyst. (a) 90 µg ml−1 B1EPH2 and 50 mM of both enantiomers of styrene oxide. (b) 1250 µg ml−1 B1EPH2 and 100 mM of both enantiomers of epichlorohydrin. (c) 1250 µg ml−1 B1EPH2 and 100 mM of both enantiomers of 1,2-epoxybutane.

3.2. Structure of B1EPH2

The B1EPH2 crystals belong to space group P4122 and diffract to a maximum resolution of 2.2 Å. Further data on X-ray data processing are summarized in Table 4[link]. The structure of B1EPH2 was solved by molecular replacement using the structure of the soluble epoxide hydrolase B from M. tuberculosis (MtEHB; James et al., 2008[James, M. N. G., Biswal, B. K., Cherney, M. M., Garen, C., Niu, C., Hammock, B. D., Morisseau, C. & Garen, G. (2008). J. Mol. Biol. 381, 897-912.]), which shares an identity of about 49%. The final model of B1EPH2 consists of 8049 non-H atoms and has an R factor and Rfree of 18.2% and 24.0%, respectively (Table 5[link]). The atomic coordinates and structure factors have been deposited in the PDB as entry 6unw. The asymmetric unit of B1EPH2 contains three protomers, each with a molecular mass of 37 kDa, which generate a hexamer through twofold crystallographic symmetry; consequently, the protomers in the asymmetric unit are connected by a threefold axis (Fig. 3[link]a), supporting the results obtained from analytical gel filtration, in which the protein eluted with a retention time corresponding to 252 kDa, matching a hexameric quaternary structure (Supplementary Fig. S1).

Table 4
Data-collection and processing statistics for B1EPH2

Values in parentheses are for the outer shell.

Diffraction source MX2, LNLS
Wavelength (Å) 1.48
Temperature (K) 100
Detector PILATUS 2M
Rotation range per image (°) 0.2
Total rotation range (°) 360
Exposure time per image (s) 2
Space group P4122
a, b, c (Å) 106.7, 106.7, 233.0
Resolution range (Å) 48.50–2.21 (2.26–2.21)
Total No. of reflections 1184544 (50856)
No. of unique reflections 67798 (42806)
Completeness (%) 99.5 (95.0)
Multiplicity 17.5 (11.9)
〈I/σ(I)〉 22.0 (2.1)
CC1/2 0.999 (0.706)
Rp.i.m. 0.041 (0.506)
Rr.i.m.† 0.124 (12.43)
Overall B factor from Wilson plot (Å2) 29.1
†Estimated Rr.i.m. = Rmerge[N/(N − 1)]1/2, where N is the data multiplicity.

Table 5
Structure-solution and refinement statistics for B1EPH2

Values in parentheses are for the outer shell.

Resolution range (Å) 48.52–2.21 (2.29–2.21)
Completeness (%) 94.9 (96.7)
No. of reflections, working set 64933 (6476)
No. of reflections, test set 3267 (362)
Final Rcryst 0.187 (0.276)
Final Rfree 0.227 (0.326)
No. of non-H atoms
 Total 8098
 Protein 7485
 Ligand (ions and cacodylate) 20
 Solvent 593
R.m.s. deviations
 Bond lengths (Å) 0.009
 Angles (°) 1.25
Average B factors (Å2)
 Protein 39.60
 Solvent 41.57
 Ligands 61.43
Ramachandran plot
 Most favored (%) 97.20
 Allowed 2.07
 Outliers (%) 0.73
Rotamer outliers (%) 0.68
Clashscore 7.39
No. of TLS groups 1
[Figure 3]
Figure 3
Overall structure of B1EPH2. (a) Quaternary structure of B1EPH2. (b) Contacts between protomers A and B. (c) Contacts between protomers B and C. (d) Monomer of B1EPH2 indicating the cap domain (green) and catalytic domain (purple) and the active-site groove between them (blue). (e) The active site of B1EPH2, indicating the essential residues for catalysis. W is a water molecule.

The r.m.s.d. for superposition of the three different protomers in the asymmetric unit is about 0.3 Å, indicating that they are very similar and there are no large conformation changes between them. This is, at least to our knowledge, the first description of a hexameric soluble epoxide hydrolase, in contrast to several dimeric soluble EHs (Mowbray et al., 2006[Mowbray, S. L., Elfström, L. T., Ahlgren, K. M., Andersson, C. E. & Widersten, M. (2006). Protein Sci. 15, 1628-1637.]; Gomez et al., 2004[Gomez, G. A., Morisseau, C., Hammock, B. D. & Christianson, D. W. (2004). Biochemistry, 43, 4716-4723.]; James et al., 2008[James, M. N. G., Biswal, B. K., Cherney, M. M., Garen, C., Niu, C., Hammock, B. D., Morisseau, C. & Garen, G. (2008). J. Mol. Biol. 381, 897-912.]; Argiriadi et al., 1999[Argiriadi, M. A., Morisseau, C., Hammock, B. D. & Christianson, D. W. (1999). Proc. Natl Acad. Sci. USA, 96, 10637-10642.]) and a monomeric soluble EH characterized by our research group (Wilson et al., 2017[Wilson, C., De Oliveira, G. S., Adriani, P. P., Chambergo, F. S. & Dias, M. V. B. (2017). Biochim. Biophys. Acta, 1865, 1039-1045.]; de Oliveira, Adriani et al., 2019[Oliveira, G. S. de, Adriani, P. P., Ribeiro, J. A., Morisseau, C., Hammock, B. D., Dias, M. V. B. & Chambergo, F. S. (2019). Int. J. Biol. Macromol. 129, 653-658.]). The hexamer is stabilized predominantly by hydrophobic inter­actions, with similar interaction surfaces of 724 and 708 Å2 between protomers A and B and protomers B and C, respectively, and with a further nine and 14 ionic interactions observed between protomers A and B and protomers B and C, respectively (Supplementary Fig. S2). Interestingly, the interaction surface between protomers A and B is similar to that observed in the dimeric structure of the soluble EH from M. tuberculosis (Fig. 3[link]b), while the interaction surface between protomers B and C (Fig. 3[link]c) has not been observed in any other dimeric soluble EHs, including human epoxide hydrolase (hEPH; James et al., 2008[James, M. N. G., Biswal, B. K., Cherney, M. M., Garen, C., Niu, C., Hammock, B. D., Morisseau, C. & Garen, G. (2008). J. Mol. Biol. 381, 897-912.]).

Each protomer of B1EPH2 adopts a classical α/β-hydrolase fold, which consists of a cap domain, which is the more flexible and less conserved region, constituted of six α-helices, and a catalytic domain. The catalytic domain is highly conserved among different soluble EHs and adopts a typical eight-stranded β-sheet with two antiparallel and six parallel strands, which are sandwiched by four α-helices, two on one side and two on the other side of the β-sheet (Fig. 3[link]d).

Similarly to other soluble EHs, the active site of B1EPH2 is located in a large groove of about 35 Å between the cap and hydrolase domains, and residues from both domains participate in catalysis. The conserved catalytic triad is placed in the hydrolase domain and is constituted by Asp114, His312 and Asp281. On the other hand, two conserved tyrosine residues, Tyr163 and Tyr251, are located in the cap domain (Fig. 3[link]e). The role of these active-site residues has already been well characterized in various epoxide hydrolases and the mechanism of catalysis of B1EPH2 should be similar to those described previously (Nardini et al., 2001[Nardini, M., Rink, R., Janssen, D. B. & Dijkstra, B. W. (2001). J. Mol. Catal. B Enzym. 11, 1035-1042.]).

3.2.1. Electron density in the active site of B1EPH2

Although several attempts were made to obtain the structure of B1EPH2 in the presence of valpromide, a known epoxide hydrolase inhibitor, our results do not indicate any electron density corresponding to this ligand. There is, however, electron density in the active site of B1EPH2 which has been modeled as cacodylate. Although cacodylate has not been reported to be an inhibitor of epoxide hydrolases, it could bind to the active site of the enzyme owing to the high concentration of this molecule used in the crystallization condition. Fig. 4[link] shows cacodylate modeled in protomer A of B1EHP2. The cacodylate makes interactions with key residues of the active site, including Asp114 from the catalytic domain and Tyr116 and Tyr251 from the cap domain. Further studies are necessary to determine whether cacodylate could be an authentic epoxide hydrolase inhibitor.

[Figure 4]
Figure 4
Electron density observed in the active site of B1EPH2 possibly occupied by a cacodylate molecule. The dotted lines are hydrogen-bond interactions between the cacodylate molecule and active-site residues. Distances are given in Å.
3.2.2. B1EPH2 and other microbial EHs

As observed for EHB from M. tuberculosis, B1EPH2 has several hydrophobic aromatic residues in the catalytic groove that could drive the specificity of this enzyme. Although several of these residues are conserved when B1EPH2 is compared with MtEHB, other residues such as Tyr188, Leu193, Phe206, Val164, Phe162 and Phe165 are not conserved and should alter the volume and charge of the active site. Besides, the active site of B1EPH2 is larger than that of MtEHB because of an insertion between Gly133 and Pro143 in MtEHB that protrudes into the active-site cavity and considerably reduces its volume (129 Å3). In contrast, similar to that of human hEPH, the B1EPH2 active site has a volume of approximately 630 Å3 according to the POCASA webserver (Yu et al., 2010[Yu, J., Zhou, Y., Tanaka, I. & Yao, M. (2010). Bioinformatics, 26, 46-52.]). Interestingly, although B1EPH2 has a higher similarity to MtEHB (49%), as they are from phylogenetically related microorganisms, the active-site cavity volume of B1EPH2 is much more similar to that of the human epoxide hydrolase (36% similarity), which explains its high acceptance of larger substrates (Fig. 5[link]). However, we could not observe any correlation between the structure of B1EPH2 and its high activity with several specific alternative substrates assayed here.

[Figure 5]
Figure 5
B1EPH2 active site showing a superposition of the secondary elements of B1EPH2 (blue), MtEHB (green) and hEPH (pink). The loop corresponding to residues 142–148 of B1EPH2 is shown in darker colors.

4. Conclusions

This work shows the structural and catalytic features of a putative α/β-epoxide hydrolase encoded by the genome of Streptomyces sp. CBMAI 2042. A genome-guided strategy facilitated the annotation of the gene as b1eph2. Gene cloning and expression led to the production of B1EPH2, which is the first hexameric EH to be characterized. Enzymatic assays confirmed the activity of B1EPH2 as an epoxide hydrolase that accepts a wide range of substrates. The enzyme is slightly enantioselective towards several substrates. Based on structural studies, we speculate that B1EPH2 should have a similar specificity for longer-chain substituted substrates to that observed for human epoxide hydrolase, despite its highest sequence similarity being to M. tuberculosis EHB, which has an insertion that protrudes into the active site and decreases the size of its cavity. Based on this, the active site of B1EPH2 is comparable to that of the human enzyme in volume. However, B1EPH2 also has several nonconserved amino-acid residues in the active site that could drive its specificity to particular substrates. Further experiments such as site-directed mutagenesis of hydrophobic residues in the B1EPH2 active site will be conducted to tackle the specificity and tune the enantio­selectivity of this enzyme and its potential as a biocatalyst for chemoenzymatic applications.

5. Related literature

The following references are cited in the supporting information for this article: Laskowski et al. (2018[Laskowski, R. A., Jabłońska, J., Pravda, L., Vařeková, R. S. & Thornton, J. M. (2018). Protein Sci. 27, 129-134.]).

Supporting information


Footnotes

‡These authors contributed equally.

Funding information

The following funding is acknowledged: São Paulo Research Foundation (grant Nos. 2011/06209-3, 2014/12727-5, 2014/50249-8 and 2019/10564-5 to Luciana G. de Oliveira; grant Nos. 2010/15971-3, 2015/09188-8 and 2018/00351-1 to Marcio Vinicius Bertacine Dias; scholarship No. 2013/26242-0 to Jademilson Celestino dos Santos); Conselho Nacional de Desenvolvimento Científico e Tecnológico (award No. 313492/2017-4 to Luciana G. de Oliveira; award No. 302848/2017-7 to Marcio Vinicius Bertacine Dias); Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (scholarship No. 001 to Gabriela D. Tormet-González; scholarship No. 001 to Carolina Wilson); L'Oréal–UNESCO–ABC Prize for Women in Science (Luciana G. de Oliveira, 2008).

References

First citationAfonine, P. V., Grosse-Kunstleve, R. W., Echols, N., Headd, J. J., Moriarty, N. W., Mustyakimov, M., Terwilliger, T. C., Urzhumtsev, A., Zwart, P. H. & Adams, P. D. (2012). Acta Cryst. D68, 352–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationArand, M., Hallberg, B. M., Zou, J., Bergfors, T., Oesch, F., van der Werf, M. J., de Bont, J. A., Jones, T. A. & Mowbray, S. L. (2003). EMBO J. 22, 2583–2592.   Web of Science CrossRef PubMed CAS Google Scholar
First citationArchelas, A. & Furstoss, R. (2001). Curr. Opin. Chem. Biol. 5, 112–119.  Web of Science CrossRef PubMed CAS Google Scholar
First citationArgiriadi, M. A., Morisseau, C., Hammock, B. D. & Christianson, D. W. (1999). Proc. Natl Acad. Sci. USA, 96, 10637–10642.  Web of Science CrossRef PubMed CAS Google Scholar
First citationBadalassi, F., Wahler, D., Klein, G., Crotti, P. & Reymond, J. (2000). Angew. Chem. Int. Ed. 39, 4067–4070.  CrossRef CAS Google Scholar
First citationChen, C. S., Fujimoto, Y., Girdaukas, G. & Sih, C. J. (1982). J. Am. Chem. Soc. 104, 7294–7299.  CrossRef CAS Web of Science Google Scholar
First citationChen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12–21.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationDavids, T., Schmidt, M., Böttcher, D. & Bornscheuer, U. T. (2013). Curr. Opin. Chem. Biol. 17, 215–220.  Web of Science CrossRef CAS PubMed Google Scholar
First citationDecker, M., Arand, M. & Cronin, A. (2009). Arch. Toxicol. 83, 297–318.  Web of Science CrossRef PubMed CAS Google Scholar
First citationDutton, C. J., Banks, B. J. & Cooper, C. B. (1995). Nat. Prod. Rep. 12, 165.  CrossRef PubMed Web of Science Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEvans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204–1214.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFaber, K. (2011). Biotransformations in Organic Chemistry. Berlin: Springer-Verlag.  Google Scholar
First citationFluxá, V. S., Wahler, D. & Reymond, J.-L. (2008). Nat. Protoc. 3, 1270–1277.  Web of Science PubMed Google Scholar
First citationFretland, A. J. & Omiecinski, C. J. (2000). Chem. Biol. Interact. 129, 41–59.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGomez, G. A., Morisseau, C., Hammock, B. D. & Christianson, D. W. (2004). Biochemistry, 43, 4716–4723.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGuérard-Hélaine, C., de Berardinis, V., Besnard-Gonnet, M., Darii, E., Debacker, M., Debard, A., Fernandes, C., Hélaine, V., Mariage, A., Pellouin, V., Perret, A., Petit, J.., Sancelme, M., Lemaire, M. & Salanoubat, M. (2015). ChemCatChem, 7, 1871–1879.  Google Scholar
First citationHammock, B. D., Grant, D. F. & Storms, D. H. (1997). Comprehensive Toxicology, Vol. 3, edited by F. P. Guengerich, pp. 283–305. Oxford: Pergamon.  Google Scholar
First citationHorsman, G. P., Lechner, A., Ohnishi, Y., Moore, B. S. & Shen, B. (2013). Biochemistry, 52, 5217–5224.  Web of Science CrossRef CAS PubMed Google Scholar
First citationJames, M. N. G., Biswal, B. K., Cherney, M. M., Garen, C., Niu, C., Hammock, B. D., Morisseau, C. & Garen, G. (2008). J. Mol. Biol. 381, 897–912.  Web of Science PubMed Google Scholar
First citationJanes, L. E. & Kazlauskas, R. J. (1997). J. Org. Chem. 62, 4560–4561.  CrossRef CAS Web of Science Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKotik, M., Štěpánek, V., Grulich, M., Kyslík, P. & Archelas, A. (2010). J. Mol. Catal. B Enzym. 65, 41–48.  Web of Science CrossRef CAS Google Scholar
First citationLaskowski, R. A., Jabłońska, J., Pravda, L., Vařeková, R. S. & Thornton, J. M. (2018). Protein Sci. 27, 129–134.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLi, N., Zhang, Y. & Feng, H. (2009). Acta Biochim. Biophys. Sin. (Shanghai), 41, 638–647.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
First citationLint, M. J. van, Gümüs, A., Ruijter, E., Faber, K., Orru, R. V. A. & Hall, M. (2019). Adv. Synth. Catal. 361, 813–825.  Google Scholar
First citationMantovani, S. M., de Oliveira, L. G. & Marsaioli, A. J. (2008). J. Mol. Catal. B Enzym. 52–53, 173–177.  Web of Science CrossRef CAS Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMorisseau, C. & Hammock, B. D. (2005). Annu. Rev. Pharmacol. Toxicol. 45, 311–333.  Web of Science CrossRef PubMed CAS Google Scholar
First citationMowbray, S. L., Elfström, L. T., Ahlgren, K. M., Andersson, C. E. & Widersten, M. (2006). Protein Sci. 15, 1628–1637.  Web of Science CrossRef PubMed CAS Google Scholar
First citationNardini, M., Ridder, I. S., Rozeboom, H. J., Kalk, K. H., Rink, R., Janssen, D. B. & Dijkstra, B. W. (1999). J. Biol. Chem. 274, 14579–14586.  Web of Science CrossRef PubMed CAS Google Scholar
First citationNardini, M., Rink, R., Janssen, D. B. & Dijkstra, B. W. (2001). J. Mol. Catal. B Enzym. 11, 1035–1042.  Web of Science CrossRef CAS Google Scholar
First citationOliveira, G. S. de, Adriani, P. P., Ribeiro, J. A., Morisseau, C., Hammock, B. D., Dias, M. V. B. & Chambergo, F. S. (2019). Int. J. Biol. Macromol. 129, 653–658.  Web of Science PubMed Google Scholar
First citationOliveira, L. G. de, Sigrist, R., Paulo, B. S. & Samborskyy, M. (2019). Microbiol. Resour. Announc. 8, e01426-18.  Web of Science CrossRef PubMed Google Scholar
First citationPaulo, B. S., Sigrist, R., Angolini, C. F. F. & De Oliveira, L. G. (2019). ChemistrySelect, 4, 7785–7790.  Web of Science CrossRef CAS Google Scholar
First citationPaulo, B. S., Sigrist, R., Angolini, C. F. F., Eberlin, M. N. & De Oliveira, L. G. (2019). J. Braz. Chem. Soc. 30, 673–679.  CAS Google Scholar
First citationPedragosa-Moreau, S., Archelas, A. & Furstoss, R. (1995). Bull. Soc. Chim. Fr. 132, 769–800.  CAS Google Scholar
First citationPedragosa-Moreau, S., Morisseau, C., Zylber, J., Archelas, A., Baratti, J. & Furstoss, R. (1996). J. Org. Chem. 61, 7402–7407.  PubMed CAS Web of Science Google Scholar
First citationSaini, P. & Sareen, D. (2017). Mol. Biotechnol. 59, 98–116.  Web of Science CrossRef CAS PubMed Google Scholar
First citationSaini, P. & Sareen, D. (2019). Nanoscience and Biotechnology for Environmental Applications, edited by K. Gothandam, S. Ranjan, N. Dasgupta & E. Lichtfouse, pp. 141–198. Cham: Springer.  Google Scholar
First citationSavle, P. S., Lamoreaux, M. J., Berry, J. F. & Gandour, R. D. (1998). Tetrahedron Asymmetry, 9, 1843–1846.  Web of Science CrossRef CAS Google Scholar
First citationSigrist, R., Luhavaya, H., McKinnie, S. M. K., Ferreira da Silva, A., Jurberg, I. D., Moore, B. S. & de Oliveira, L. G. (2020). ACS Chem. Biol. 15, 1067–1077.  Web of Science CrossRef CAS PubMed Google Scholar
First citationSigrist, R., Paulo, B. S., Angolini, C. F. F. & de Oliveira, L. G. (2020). J. Vis. Exp., e60825.  Google Scholar
First citationSinal, C. J., Miyata, M., Tohkin, M., Nagata, K., Bend, J. R. & Gonzalez, F. J. (2000). J. Biol. Chem. 275, 40504–40510.  Web of Science CrossRef PubMed CAS Google Scholar
First citationTormet-Gonzalez, G. D. & de Oliveira, L. G. (2018a). Brazilian Patent BR102016026341-7A.  Google Scholar
First citationTormet-Gonzalez, G. D. & de Oliveira, L. G. (2018b). World Patent WO2018085906A1.  Google Scholar
First citationVries, E. J. de & Janssen, D. B. (2003). Curr. Opin. Biotechnol. 14, 414–420.  Web of Science PubMed Google Scholar
First citationWilson, C., De Oliveira, G. S., Adriani, P. P., Chambergo, F. S. & Dias, M. V. B. (2017). Biochim. Biophys. Acta, 1865, 1039–1045.  Web of Science CrossRef CAS Google Scholar
First citationWinn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationYu, J., Zhou, Y., Tanaka, I. & Yao, M. (2010). Bioinformatics, 26, 46–52.  Web of Science CrossRef PubMed Google Scholar
First citationZhang, J.-D., Yang, X.-X., Jia, Q., Zhao, J.-W., Gao, L.-L., Gao, W.-C., Chang, H.-H., Wei, W.-L. & Xu, J.-H. (2019). Catal. Sci. Technol. 9, 70–74.  Web of Science CrossRef CAS Google Scholar
First citationZou, J., Hallberg, B. M., Bergfors, T., Oesch, F., Arand, M., Mowbray, S. L. & Jones, T. A. (2000). Structure, 8, 111–122.  Web of Science CrossRef PubMed CAS Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983
Follow Acta Cryst. D
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds