research papers\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983

Structures of permuted halves of a modern ribose-binding protein

crossmark logo

aDepartment of Biochemistry, University of Bayreuth, 95447 Bayreuth, Germany
*Correspondence e-mail: [email protected]

Edited by P. Langan, Institut Laue-Langevin, Grenoble, France (Received 2 August 2022; accepted 13 December 2022)

Periplasmic binding proteins (PBPs) are a class of proteins that participate in the cellular transport of various ligands. They have been used as model systems to study mechanisms in protein evolution, such as duplication, recombination and domain swapping. It has been suggested that PBPs evolved from precursors half their size. Here, the crystal structures of two permuted halves of a modern ribose-binding protein (RBP) from Thermotoga maritima are reported. The overexpressed proteins are well folded and show a monomer–dimer equilibrium in solution. Their crystal structures show partially noncanonical PBP-like fold type I conformations with structural deviations from modern RBPs. One of the half variants forms a dimer via segment swapping, suggesting a high degree of malleability. The structural findings on these permuted halves support the evolutionary hypothesis that PBPs arose via a duplication event of a flavodoxin-like protein and further support a domain-swapping step that might have occurred during the evolution of the PBP-like fold, a process that is necessary to generate the characteristic motion of PBPs essential to perform their functions.

1. Introduction

Understanding the emergence of modern protein structures can be addressed by investigating the mechanisms that evolution might have employed. Some of the drivers for structural diversification are genetic mechanisms, such as mutation, duplication and recombination of domain-sized or even subdomain-sized protein fragments, offering the structural complexity needed for functions to evolve (Romero-Romero et al., 2021[Romero-Romero, S., Kordes, S., Michel, F. & Höcker, B. (2021). Curr. Opin. Struct. Biol. 68, 94-104.]; Sikosek & Chan, 2014[Sikosek, T. & Chan, H. S. (2014). J. R. Soc. Interface, 11, 20140419.]; Höcker, 2014[Höcker, B. (2014). Curr. Opin. Struct. Biol. 27, 56-62.]; Ohta, 2000[Ohta, T. (2000). Philos. Trans. R. Soc. London B, 355, 1623-1626.]). Another mechanism expanding this repertoire is domain swapping. While domain swapping does not lead to a change in protein sequence, its influence on the structure by forming oligomers via exchange of structural elements within the topology of a protein also contributes to the emergence of functions (Bennett et al., 1995[Bennett, M. J., Schlunegger, M. P. & Eisenberg, D. (1995). Protein Sci. 4, 2455-2468.]). Insights into these characteristics can shed light not only on the evolutionary history of proteins but also on our understanding of the determinants of protein folding in general.

One group of proteins that have been used for this purpose are periplasmic binding proteins (PBPs). They are involved in the cellular transport of a wide variety of small molecules such as carbohydrates, amino acids, vitamins and ions (Chandra­vanshi et al., 2021[Chandravanshi, M., Tripathi, S. K. & Kanaujia, S. P. (2021). FEBS Lett. 595, 2395-2409.]; Felder et al., 1999[Felder, C. B., Graul, R. C., Lee, A. Y., Merkle, H. P. & Sadee, W. (1999). AAPS PharmSci, 1, E2.]). The structurally symmetric bilobal architecture of their fold has long been thought to originate from a duplication and fusion event of an individual lobe (Fukami-Kobayashi et al., 1999[Fukami-Kobayashi, K., Tateno, Y. & Nishikawa, K. (1999). J. Mol. Biol. 286, 279-290.]; Louie, 1993[Louie, G. V. (1993). Curr. Opin. Struct. Biol. 3, 401-408.]). While more detailed classifications of their fold exist (Scheepers et al., 2016[Scheepers, G. H., Lycklama a Nijeholt, J. A. & Poolman, B. (2016). FEBS Lett. 590, 4393-4401.]), they can be structurally separated into PBP-like fold types I and II, with somewhat different arrangements of secondary-structure elements. It has been proposed that type II PBPs derive from a tandem domain swap of type I PBPs, leading to exchange of the (βα)5 elements between the lobes (Fukami-Kobayashi et al., 1999[Fukami-Kobayashi, K., Tateno, Y. & Nishikawa, K. (1999). J. Mol. Biol. 286, 279-290.]). Similar domain dislocation has previously been described in related protein folds such as the chemotaxis response regulator CheY (Paithankar et al., 2019[Paithankar, K. S., Enderle, M., Wirthensohn, D. C., Miller, A., Schlesner, M., Pfeiffer, F., Rittner, A., Grininger, M. & Oesterhelt, D. (2019). Acta Cryst. F75, 576-585.]), the receiver domain of cytokinin receptor CRE1 (Tran et al., 2021[Tran, L. H., Urbanowicz, A., Jasiński, M., Jaskolski, M. & Ruszkowski, M. (2021). Front. Plant Sci. 12, 756341.]), the tryptophan synthase subunit TrpA (Michalska et al., 2020[Michalska, K., Kowiel, M., Bigelow, L., Endres, M., Gilski, M., Jaskolski, M. & Joachimiak, A. (2020). Acta Cryst. D76, 166-175.]) and the uroporphyrinogen III synthase (Toledo-Patiño et al., 2019[Toledo-Patiño, S., Chaubey, M., Coles, M. & Höcker, B. (2019). Biochemistry, 58, 4790-4793.]; Szilágyi et al., 2017[Szilágyi, A., Györffy, D. & Závodszky, P. (2017). Proteins, 85, 46-53.]).

To investigate the structural flexibility of the α/β architecture found in type I PBPs, we separated and investigated the individual lobes of the ribose-binding protein from Thermotoga maritima (RBP; Cuneo et al., 2008[Cuneo, M. J., Beese, L. S. & Hellinga, H. W. (2008). BMC Struct. Biol. 8, 50.]). An established way to stabilize and isolate structural units within a given protein fold is the use of circular permutations (Huang, Nayak et al., 2011[Huang, Y.-M., Nayak, S. & Bystroff, C. (2011). Protein Sci. 20, 1775-1780.]; Iwakura et al., 2000[Iwakura, M., Nakamura, T., Yamane, C. & Maki, K. (2000). Nat. Struct. Biol. 7, 580-585.]; Hennecke et al., 1999[Hennecke, J., Sebbel, P. & Glockshuber, R. (1999). J. Mol. Biol. 286, 1197-1215.]). Following this approach, two protein variants that structurally represent each lobe of RBP were created and characterized (Fig. 1[link]). We successfully obtained crystal structures of both the N-terminal lobe (RBP-CPN) and the C-terminal lobe (RBP-CPC), observing a non-native swapping of elements in RBP-CPN. Our experiments also indicate dimerization of this lobe in solution, with the crystal structure showing a rearrangement reminiscent of the antiparallel β-sheet observed in type II PBPs. The observed structural malleability and the propensity to rearrange secondary-structural elements furthermore suggest a possible mechanism for transition from the type I PBP-like fold to type II via domain dislocation.

[Figure 1]
Figure 1
Secondary structure and topology of RBP and its permuted halves. (a) Secondary-structure alignment with the amino-acid sequence of RBP. Secondary-structure annotations derived from PDBsum (Laskowski et al., 2018[Laskowski, R. A., Jabłońska, J., Pravda, L., Vařeková, R. S. & Thornton, J. M. (2018). Protein Sci. 27, 129-134.]) are colored salmon for RBP, blue for RBP-CPN and yellow for RBP-CPC. β-Sheets are sequentially labeled with letters in the order of the sequence and α-helices are labeled with numbers. These labels correspond to the topology representation (b, c, d) adapted from Fukami-Kobayashi et al. (1999[Fukami-Kobayashi, K., Tateno, Y. & Nishikawa, K. (1999). J. Mol. Biol. 286, 279-290.]), where β-sheets are depicted as triangles and α-helices as circles. The arrangement of the secondary-structure elements reflects their three-dimensional order for RBP (b), RBP-CPC (c) and RBP-CPN (d). The N- and C-termini are labeled N and C, respectively, and the connections between the secondary-structure elements are shown as arrows. The connections of the two possible configurations of β-strand I, either to α-helix 8 or β-strand J′, in RBP-CPC are shown as dotted arrows as these stretches are not resolved in the crystal structure.

2. Materials and methods

2.1. Construct designs with Rosetta

The RosettaRemodel protocol included in the Rosetta suite (release 2018.19; Huang, Ban et al., 2011[Huang, P.-S., Ban, Y.-E. A., Richter, F., Andre, I., Vernon, R., Schief, W. R. & Baker, D. (2011). PLoS One, 6, e24109.]) was used to sample possible loop conformations to connect the secondary-structure elements of the RBP lobes, leading to both the RBP-CPN and RBP-CPC sequences. The unliganded structure of T. maritima RBP (PDB entry 2fn9; Cuneo et al., 2008[Cuneo, M. J., Beese, L. S. & Hellinga, H. W. (2008). BMC Struct. Biol. 8, 50.]), trimmed to include only the residues of the respective lobe, was used as a template. The new termini for the permuted constructs were introduced at positions 1 and 263 for RBP-CPN, with a loop inserted between positions 105 and 244 (strand E and helix 9; Fig. 1[link]a). For RBP-CPC the N-terminus was shifted to residue 128, and a loop was inserted to connect residue 243 to the new C-terminal stretch from 106 to 127 (strand D and helix 4; Fig. 1[link]a). Flexibility of the input model was allowed for one additional residue on each side of the gap during loop closure. 1000 models of three- and four-residue loops were generated using parallelized processing with Open MPI and procedural seed generation. The top ten scoring models were relaxed using the relax algorithm provided in this version of Rosetta, and the total and per-residue scoring functions were used. The sequences of the best scoring models for both RBP-CPN and RBP-CPC were used as final constructs (Table 1[link]). The per-residue energies of the relaxed models were compared with the unrelaxed crystal structure of RBP and the obtained crystal structures of RBP-CPN and RBP-CPC using the score_jd2 application in the same version of Rosetta.

Table 1
Sequences of full-length RBP and the permuted RBP halves

The M142A mutation in RBP and the residues inserted based on Rosetta modeling in RBP-CPN and RBP-CPC are highlighted in bold.

Name Sequence
RBP MKGKMAIVISTLNNPWFVVLAETAKQRAEQLGYEATIFDSQNDTAKESAHFDAIIAAGYDAIIFNPTDADGSIANVKRAKEAGIPVFCVDRGINARGLAVAQIYSDNYYGGVLAGEYFVKFLKEKYPDAKEIPYAELLGILSAQPTWDRSNGFHSVVDQYPEFKMVAQQSAEFDRDTAYKVTEQILQAHPEIKAIWCGNDAMALGAMKACEAAGRTDIYIFGFDGAEDVINAIKEGKQIVATIMQFPKLMARLAVEWADQYLRGERSFPEIVPVTVELVTRENIDKYTAYGRKLEHHHHHH
RBP-CPN MKGKMAIVISTLNNPWFVVLAETAKQRAEQLGYEATIFDSQNDTAKESAHFDAIIAAGYDAIIFNPTDADGSIANVKRAKEAGIPVFCVDRGINARGLAVAQIYSDTSTQFPKLMARLAVEWADQYLRGGHHHHHH
RBP-CPC MKEIPYAELLGILSAQPTWDRSNGFHSVVDQYPEFKMVAQQSAEFDRDTAYKVTEQILQAHPEIKAIWCGNDAMALGAMKACEAAGRTDIYIFGFDGAEDVINAIKEGKQIVATIMVGHNHNYYGGVLAGEYFVKFLKEKYPDGGHHHHHH

2.2. Cloning and protein purification

The gene fragments for full-length RBP as well as RBP-CPC were subcloned into empty linearized pET-21b(+) using NdeI/XhoI restriction sites. To prevent translation of the truncated sequence in wild-type RBP, an M142A mutation (Cuneo et al., 2008[Cuneo, M. J., Beese, L. S. & Hellinga, H. W. (2008). BMC Struct. Biol. 8, 50.]) was introduced via QuikChange site-directed mutagenesis. The resulting plasmids were verified by sequencing. Gene synthesis and cloning into pET-21b(+) for RBP-CPN were provided by Biocat. Transformant Escherichia coli BL21 (DE3) cells were grown in Terrific broth medium (TB) at 37°C to an OD600 of 1.2 in the presence of 100 µg ml−1 ampicillin. Protein expression was induced by the addition of 1 mM isopropyl β-D-1-thiogalactopyranoside and continued for 18 h at 20°C. The cells were harvested by centrifugation (5000g, 15 min), resuspended and lysed by sonication. To remove cell debris, the suspension was centrifuged again (40 000g, 1 h) and the supernatant was filtered through a 0.22 µm filter prior to immobilized metal ion chromatography (IMAC).

IMAC was performed on a Cytiva HisTrap 5 ml column previously equilibrated with buffer (20 mM MOPS, 500 mM NaCl, 10 mM imidazole pH 7.8). Elution was performed with a 40% step of elution buffer (20 mM MOPS, 500 mM NaCl, 600 mM imidazole pH 7.8). Fractions containing the protein of interest were pooled and concentrated for the size-exclusion chromatography step. Size-exclusion chromatography was performed on a Cytiva Superdex 26/600 75 pg column with isocratic elution of buffer (20 mM Tris–HCl, 300 mM NaCl pH 7.8). Fractions containing protein were analyzed by SDS–PAGE and those containing the proteins of interest were pooled, flash-frozen in liquid nitrogen and stored at −20°C until further analysis.

2.3. Crystallization

Initial crystallization screens were set up using a Phoenix pipetting robot (Art Robbins Instruments) with commercially available sparse-matrix screens (Qiagen; JCSG Core I–IV Suites and The PEGs Suite and PEGs Suite II) in 96-well sitting-drop plates (3-drop Intelli-Plates, Art Robbins Instruments). Droplets were pipetted in 1:1, 1:2 and 2:1 ratios of protein:reservoir solution with a protein concentration of 30 mg ml−1 and were incubated at 293 K. Initial crystals of RBP-CPN appeared after 35 days in the following condition: 30% PEG 4000, 0.2 M lithium sulfate, 0.1 M Tris–HCl pH 8.5 (JCSG Core IV Suite) in the 1:1 ratio droplet. Subsequent optimization with Additive Screen (Hampton Research) yielded well diffracting cuboid-shaped crystals in the presence of the abovementioned initial hit solution supplemented with 4% 2,2,2-trifluoroethanol. Further cryoprotection was not needed.

RBP-CPC was crystallized in the same fashion with a protein concentration of 15 mg ml−1. Diffracting cuboid-shaped crystals were found after one month in 0.2 M magnesium acetate, 20% PEG 3350 (The PEGs Suite) in the 1:2 ratio droplet. Cryoprotection was ensured by transferring the crystal to 20% PEG 3000, 20% ethylene glycol, 0.2 M KNO3.

2.4. X-ray data collection, structure determination and model building

Crystals were manually mounted using cryo-loops on SPINE standard bases and were flash-cooled after cryoprotection if needed. Diffraction data were collected on BL14.1 at the BESSY II electron-storage ring operated by the Helmholtz-Zentrum Berlin (Mueller et al., 2015[Mueller, U., Förster, R., Hellmig, M., Huschmann, F. U., Kastner, A., Malecki, P., Pühringer, S., Röwer, M., Sparta, K., Steffien, M., Ühlein, M., Wilk, P. & Weiss, M. S. (2015). Eur. Phys. J. Plus, 130, 141-151.]). Measurements were performed at 100 K in single-wavelength mode at 0.9184 Å with a Dectris PILATUS 6M detector in fine-slicing mode (0.1° wedges) using the MXCuBE beamline-control software (Gabadinho et al., 2010[Gabadinho, J., Beteva, A., Guijarro, M., Rey-Bakaikoa, V., Spruce, D., Bowler, M. W., Brockhauser, S., Flot, D., Gordon, E. J., Hall, D. R., Lavault, B., McCarthy, A. A., McCarthy, J., Mitchell, E., Monaco, S., Mueller-Dieckmann, C., Nurizzo, D., Ravelli, R. B. G., Thibault, X., Walsh, M. A., Leonard, G. A. & McSweeney, S. M. (2010). J. Synchrotron Rad. 17, 700-707.]). Data were processed with XDSAPP2 (Sparta et al., 2016[Sparta, K. M., Krug, M., Heinemann, U., Mueller, U. & Weiss, M. S. (2016). J. Appl. Cryst. 49, 1085-1092.]) employing XDS (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]). Data quality was assessed by applying phenix.xtriage (Zwart et al., 2005[Zwart, P. H., Grosse-Kunstleve, R. W. & Adams, P. D. (2005). CCP4 Newsl. Protein Crystallogr. 43, contribution 7.]). Resolution cutoffs were determined by applying the automated paired refinement protocol PAIREF (Malý et al., 2020[Malý, M., Diederichs, K., Dohnálek, J. & Kolenko, P. (2020). IUCrJ, 7, 681-692.]).

In both cases, phases were solved by molecular replacement using the respective lobe of RBP (PDB entry 2fn9) as a search model with Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]). The resulting models were manually rebuilt with Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]) and refined with phenix.refine (Afonine et al., 2018[Afonine, P. V., Poon, B. K., Read, R. J., Sobolev, O. V., Terwilliger, T. C., Urzhumtsev, A. & Adams, P. D. (2018). Acta Cryst. D74, 531-544.]) in an iterative manner. Coordinates and structure factors were validated and deposited in the PDB (Berman et al., 2002[Berman, H. M., Battistuz, T., Bhat, T. N., Bluhm, W. F., Bourne, P. E., Burkhardt, K., Feng, Z., Gilliland, G. L., Iype, L., Jain, S., Fagan, P., Marvin, J., Padilla, D., Ravichandran, V., Schneider, B., Thanki, N., Weissig, H., Westbrook, J. D. & Zardecki, C. (2002). Acta Cryst. D58, 899-907.]) with accession codes 7qsq (RBP-CPN) and 7qsp (RBP-CPC).

2.5. Far-UV circular dichroism

Far-UV circular dichroism (CD) was measured on a Jasco J-710 spectropolarimeter equipped with a Peltier device (PTC-348 WI) to control the temperature at 20°C. Before the measurements, the protein samples were dialyzed overnight into 10 mM sodium phosphate pH 7.8, 50 mM sodium chloride. Samples were measured at a protein concentration of 10 µM in a 2 mm cuvette in a wavelength range from 195 to 260 nm with a bandwidth of 1 nm. After subtraction of the buffer signal, the measured ellipticity signal was converted to mean residue molar ellipticity ([Θ]) using [Θ] = Θ/(lCNr), where Θ is the ellipticity signal in millidegrees, l is the cell path in millimetres, C is the molar protein concentration and Nr is the number of amino acids per protein (Greenfield, 2006[Greenfield, N. J. (2006). Nat. Protoc. 1, 2876-2890.]).

2.6. Intrinsic fluorescence

Intrinsic fluorescence (IF) spectra were collected on a Jasco FP-6500 spectrofluorometer. Measurements were performed at 20°C controlled with a water bath (Julabo MB). Samples were dialyzed and the concentration was set as described previously for CD measurements. The excitation wavelength was set to 280 nm and emission was measured in the range 300–500 nm with a bandwidth of 1 nm. The raw signal was corrected for protein concentration and further normalized to relative fluorescence.

2.7. Size-exclusion chromatography–multi-angle light scattering

Size-exclusion chromatography–multi-angle light scattering (SEC-MALS) measurements were performed with a miniDAWN detector and an Optilab refractometer (Wyatt Technology) coupled to an analytical size-exclusion chromatography column (Superdex 75 Increase 10/300 GL). Centrifuged samples were run on the column connected to an ÄKTApure FPLC system (GE Healthcare Life Sciences) and equilibrated with 10 mM sodium phosphate pH 7.8, 50 mM sodium chloride, 0.02% sodium azide at room temperature. Measurements were run at a constant flow rate of 0.8 ml min−1 at protein concentrations of 0.5, 1.0 and 5 mg ml−1. The system setup was normalized and checked by measurement of a commercially available standardized BSA sample (2 mg ml−1; Pierce, catalogue No. 23209) before and after each series of measurements. Weight-averaged molar-mass determination was performed using the Zimm equation with the differential refractive-index signal as a source for the concentration calculations (the refractive-index increment dn/dc was set to 0.185). Analysis of the experiments was performed using the ASTRA version 7.3.2 software suite (Wyatt Technology).

2.8. Differential scanning calorimetry

Differential scanning calorimetry (DSC) endotherms were collected using a MicroCal PEAQ-DSC instrument (Malvern Panalytical) with protein concentrations of 0.5, 1.0 and 5 mg ml−1, a temperature range of 10–130°C and a scan rate of 1.5°C min−1. All samples were prepared after exhaustive dialysis in 10 mM sodium phosphate pH 7.8, 50 mM sodium chloride. After proper instrument equilibration with at least two buffer–buffer scans, physical and chemical baselines were subtracted from protein–buffer scans and the data were normalized by protein concentration. Origin version 9.0 (OriginLab Corporation) was used for data analysis.

3. Results and discussion

3.1. Design of RBP-CPN and RBP-CPC

To assess how the individual lobes of a PBP-like fold behave, we chose the ribose-binding protein from T. maritima (RBP). Due to its thermophilic nature, it was considered to be a robust model system that could more readily tolerate this manipulation. In addition, it has previously been reported that this protein is expressed as a 21 kDa truncation (Cuneo et al., 2008[Cuneo, M. J., Beese, L. S. & Hellinga, H. W. (2008). BMC Struct. Biol. 8, 50.]), suggesting that at least some elements of this protein may exist in isolation. To isolate the two lobes of RBP, the elements that make up the individual two halves were linked together via an artificial loop (Table 1[link]). The resulting constructs RBP-CPN (N-terminal lobe) and RBP-CPC (C-terminal lobe) represent the two symmetric lobes of the PBP-like fold (Figs. 1[link]a and 1[link]b). The specific intersections were determined by structural alignment of the crystal structure of RBP from T. maritima in the absence of its ligand ribose (PDB entry 2fn9). RBP-CPN was designed to consist only of the βA–Eα1–4 elements, which are directly linked to α9. Similarly, RBP-CPC consists of the elements βF–Jα5–8 connected to α4 of RBP by permutation (Fig. 1[link]a). To be consistent with the structure of the theoretical evolutionary precursor before duplication, the additional secondary-structural elements at the C-terminus of RBP (βK–L) responsible for the second crossover between the two lobes were removed.

We obtained computational models of each lobe with comparable total and per-residue energies to the trimmed input structures of full-length RBP. Comparison of the scores obtained from the Rosetta energy function of native RBP and the models show similar energies for all structures (Figs. 2[link]a and 2[link]b). The similarity of the per-residue energy of RBP to the corresponding values for the models indicates that at least energetically, the added loop residues are suitable. The per-residue energies further show a similar distribution. For most of the sequence of RBP-CPN, the residue energies of the crystal structure are comparable to those of the model. Only the residues of the inserted loop (blue bracket in Fig. 2[link]a) score lower in the crystal structure compared to the computational model. However, the entire stretch after the inserted residues displays a higher energy (in Rosetta energy units; REU) than in the model. This is similarly reflected in both the structural rearrangement of the secondary-structure elements (Figs. 1[link]d and 2[link]c) and the per-residue r.m.s.d. in RBP-CPN (Fig. 2[link]e). The observation is consistent with the dimerization interface being facilitated via swapping of the α4 element and disruption of the expected conformation at the C-terminus. While the deviation in r.m.s.d. for RBP-CPN would imply a disturbance of per-residue energies in the C-terminal stretch (Fig. 2[link]e), the segment swap seems to compensate for it in canonical topology.

[Figure 2]
Figure 2
Per-residue Rosetta energy terms and comparison of the per-residue r.m.s.d. of the models to the crystal structure. (a, b) Energies in Rosetta energy units (REU) for each residue position of the template RBP structure (black, circles, dashed line), the model of RBP-CPN or RBP-CPC (gray, squares, solid line) and the respective crystal structures (blue for RBP-CPN and yellow for RBP-CPC, triangles, dashed lines). Sites where loop residues were introduced are highlighted by colored brackets for each protein. Secondary-structural elements as observed in the crystal are shown and are labeled as in Fig. 1[link](a). (c, d) Superposition of the computational models (gray) and the corresponding crystal structures of RBP-CPN (blue) and RBP-CPC (yellow). The borders of the area of missing density in RBP-CPC are labeled D96 and M116. (e, f) Per-residue r.m.s.d. (based on Cα atoms) of the obtained crystal structures of RBP-CPN (blue) and RBP-CPC (yellow) compared with their models. The representation and alignment were obtained using PyMOL 2.5.0 (Schrödinger) and the align command with cycles=0, considering only Cα atoms of chains A and transferring per-residue values with the rmsd_b script (https://pldserver1.biochem.queensu.ca/~rlc/work/pymol/rmsd_b.py).

In contrast, a comparison of the scores of the RBP-CPC model and its resulting crystal structure shows similar energies for all resolved residues (Fig. 2[link]b). The per-residue energies of the designed loop are also comparable, even though their conformation in the crystal differs significantly from the model (yellow bracket in Fig. 2[link]b). Apart from the residues around the stretch of missing density (Asp96–Met116), the predicted structure corresponds well to the obtained crystal structure (Fig. 2[link]d) and the per-residue r.m.s.d. values also indicate good agreement (Fig. 2[link]f).

3.2. Both lobes are stable proteins with a tendency to form dimers

RBP-CPN and RBP-CPC could be expressed recombinantly in high yields in E. coli and purified to homogeneity. Far-UV CD spectra of both RBP-CPN and RBP-CPC show typical characteristics of a protein with an α/β-like structure and are comparable to that of full-length RBP (Fig. 3[link]a). In addition, an initial hint about the correct formation of the tertiary structure in solution was obtained from the intrinsic fluorescence spectra. The emission maximum at 335 nm for both proteins as well as for RBP indicates that the aromatic residues are in a hydrophobic core and are buried from solvent, confirming that all proteins adopt a comparable compact structure (Fig. 3[link]b). Another indication that the constructs appear to fold stably is the determination of thermal stability by differential scanning calorimetry (DSC). The DSC endotherms obtained for both RBP-CPN and RBP-CPC show a single and highly cooperative transition (Fig. 3[link]c). The thermal unfolding appears to be irreversible, as no transition is observed upon cooling and the measurement of a second heating cycle. The permuted constructs show a lower thermostability than full-length RBP, with Tm values of 76.1 ± 0.4°C for RBP-CPC and 97.9 ± 0.9°C for RBP-CPN, in contrast to 108°C for RBP (Cuneo et al., 2008[Cuneo, M. J., Beese, L. S. & Hellinga, H. W. (2008). BMC Struct. Biol. 8, 50.]). There also appears to be a small dependence on protein concentration, with a shift to higher transition temperatures at higher protein concentrations (Fig. 3[link]c).

[Figure 3]
Figure 3
Biochemical characterization. (a) Far-UV CD spectra of RBP (salmon), RBP-CPN (blue) and RBP-CPC (yellow). (b) Normalized tryptophan fluorescence at a 280 nm excitation wavelength of RBP (salmon), RBP-CPN (blue) and RBP-CPC (yellow). (c) DSC endotherms of RBP (salmon), RBP-CPN (blue) and RBP-CPC (yellow); sample concentrations of 0.5, 1 and 5 mg ml−1 are shown as solid, dashed and dotted lines, respectively. (d) SEC-MALS analysis of RBP-CPN (blue) and RBP-CPC (yellow) at different concentrations. The elution profile is plotted as the relative differential refractive index against the retention time. Sample concentrations of 0.5, 1 and 5 mg ml−1 are shown as solid, dashed and dotted lines, respectively. Molar-mass determinations for peak regions are plotted as gray dots.

Since the architecture of PBPs is likely to have originated from an ancestral dimer with the canonical binding site between the lobes, the question arises whether both variants can adopt a similar conformation. To investigate this, the oligomeric state of the proteins was determined in solution using SEC-MALS measurements (Fig. 3[link]d). In the concentration range 0.5–5 mg ml−1, the determined molecular weight (MW) of RBP-CPN is approximately 27.5 kDa. This corresponds to a dimeric conformation, as it is about double the expected monomeric MW of 14.9 kDa. The shift from lower molecular weight at lower concentrations to higher molecular weight at higher concentrations indicates that the monomer–dimer equilibrium is dynamic and concentration-dependent. A similar pattern is observed for RBP-CPC. While the protein appears to be monomeric at low concentrations (0.5 mg ml−1), the MW shifts to 18.7 kDa at 1 mg ml−1 and to 22.4 kDa at 5 mg ml−1. This would correspond to a dynamic shift from a monomer (theoretical MW of 16.7 kDa) to a dimer (Table 2[link]). These results are in agreement with the concentration-dependent thermostability observed in DSC measurements. Together, they explain the shift to higher temperatures during thermal unfolding, with possible stabilization of the overall fold by forming a defined dimer interface.

Table 2
Molecular-weight determination with SEC-MALS

Sample (concentration) Expected MW (kDa) Experimental MW (kDa) Uncertainty (%)
RBP-CPN (0.5 mg ml−1) 14.9 26.8 0.8
RBP-CPN (1.0 mg ml−1) 27.2 0.5
RBP-CPN (5.0 mg ml−1) 28.5 0.3
RBP-CPC (0.5 mg ml−1) 16.7 18.0 1.0
RBP-CPC (1.0 mg ml−1) 18.7 0.7
RBP-CPC (5.0 mg ml−1) 22.4 0.4

3.3. The structures of both RBP-CPN and RBP-CPC differ from their native counterparts

The PBP-like type I canonical fold consists of two lobes with a continuous, parallel β-sheet with five strands in the order 21345 plus an additional, noncontinuous β6 strand flanked by alternating α-helices on each side and one crossover between each lobe (Figs. 1[link]a and 1[link]b). In contrast to the expected single-lobed architecture, the crystal structures obtained for RBP-CPN and RBP-CPC deviate from the structure of full-length RBP.

RBP-CPC crystallized in the orthorhombic space group P212121, with two chains of the protein in the asymmetric unit, and was refined to a resolution of 1.36 Å (Table 3[link]). While the N-terminal (αβ)4 elements in both chains are nearly identical to the core of the corresponding part in full-length RBP, the remaining elements differ from the canonical topology (Figs. 1[link]b and 1[link]c). While the core structure of α5–7 and βF–I in RBP-CPC is comparable to that of RBP, the following βJ strand and the synthetic loop are not resolved in the crystal structure (Fig. 4[link]a). However, the connecting α8 helix on the other side of this gap in the structure can unambiguously be seen (Fig. 1[link]c). It remains unclear whether the inserted loop or the energetical frustration of missing elements on this terminal side of the protein interferes with the proper formation of βJ, or whether a preferential but unobserved swap of elements with an adjacent protein molecule results in the lack of density in this protein region (Fig. 4[link]e). An alternative explanation could be the formation of an interface between two crystallographic dimers, as indicated by an analysis with the PISA server (Krissinel & Henrick, 2007[Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774-797.]). In this case, the C-terminal α8 would not originate from the same chain of the asymmetric unit but from its corresponding symmetry mate. The resulting extended arrangement is facilitated by an interaction of the βI strand and the residue stretch 116′–120′ (Fig. 5[link]a). This extension is similar to a continuation of the sheet via the antiparallel addition of a short, single stretch resembling a strand, with the residues of the designed loop (Val117–His121) participating in the interaction (Fig. 1[link]c). With the α4 helix originating from the adjacent symmetry mate, it is also possible that there is a mixed population of both conformations, with the helix serving as a common structural anchor point. This could also explain the lack of density in the connecting area. A similar shuffling of elements can be observed with less ambiguity in the crystal structure of RBP-CPN (Fig. 5[link]b). This possible interaction could also explain the concentration-dependent oligomerization observed in the SEC-MALS measurements (Fig. 3[link]d). The central β-sheet as well as all α-helices appear to be well ordered, except for the loops close to the unresolved region and the termini. The r.m.s.d. of 0.5 Å over 135 Cα atoms of the resolved residues, however, indicates a high similarity between RBP-CPC and the corresponding elements of full-length RBP (Fig. 4[link]c).

Table 3
Crystallographic data and refinement statistics

  RBP-CPN RBP-CPC
PDB code 7qsq 7qsp
Wavelength (Å) 0.9184 0.9184
Resolution range (Å) 48.96–1.79 (1.86–1.79) 39.76–1.36 (1.40–1.36)
Space group P21 P212121
a, b, c (Å) 55.37, 62.77, 76.26 41.69, 41.97, 132.20
α, β, γ (°) 90, 102.1, 90 90, 90, 90
Total reflections 176181 (15604) 533879 (48154)
Unique reflections 47556 (4346) 50883 (4875)
Multiplicity 3.7 (3.6) 10.5 (9.9)
Completeness (%) 97.8 (85.5) 99.0 (96.7)
Mean I/σ(I) 8.58 (0.76) 13.93 (1.00)
Wilson B factor (Å2) 32.6 18.8
No. of molecules in asymmetric unit 4 2
Matthews coefficient (Å3 Da−1) 2.14 1.72
Rmerge 0.080 (1.324) 0.081 (1.907)
Rmeas 0.094 (1.548) 0.085 (2.008)
Rp.i.m. 0.047 (0.788) 0.026 (0.616)
CC1/2 0.997 (0.413) 0.999 (0.322)
CC* 0.999 (0.765) 1.000 (0.698)
Reflections used in refinement 47294 (4102) 50883 (4875)
Reflections used for Rfree 2088 (181) 2100 (201)
Rwork 0.191 (0.370) 0.171 (0.353)
Rfree 0.239 (0.396) 0.210 (0.380)
CCwork 0.963 (0.685) 0.962 (0.605)
CCfree 0.952 (0.532) 0.938 (0.554)
No. of non-H atoms
 Total 4446 2308
 Macromolecules 4063 2073
 Solvent 315 199
No. of protein residues 510 248
R.m.s.d., bond lengths (Å) 0.003 0.012
R.m.s.d., bond angles (°) 0.57 1.23
Ramachandran favored (%) 98.4 99.2
Ramachandran allowed (%) 1.4 0.8
Ramachandran outliers (%) 0.2 0.0
Rotamer outliers (%) 1.4 1.4
Clashscore 5.16 4.82
Average B factor (Å2)
 Overall 40.0 25.9
 Macromolecules 39.2 24.6
 Solvent 46.5 35.9
No. of TLS groups 4 2
[Figure 4]
Figure 4
Comparison of the crystal structures of the individual lobes with full-length RBP. (a) Cartoon representation of the structural alignment of the two chains in the asymmetric unit of RBP-CPC, with the edges of the unresolved region of chains A (Asp95–Met116) and B (Ala98–Met116) shown as spheres. (b) Cartoon representation of the crystallographic dimer of RBP-CPN. (c, d) Superposition of the cartoon structures of full-length RBP with RBP-CPC (c) and RBP-CPN (d), respectively. R.m.s.d. values over all Cα atoms of chain A of each structure are provided next to each figure. (e) Missing density in the RBP-CPC map spanning residues Asp96–Met116. The crystal structure is shown as sticks, where chain A is colored yellow and symmetry mates are colored gray. A stick representation of the corresponding Rosetta model (residues Ile92–Gly125) is shown as an overlay in cyan. Water molecules are depicted as red spheres. A 2Fo − Fc map contoured at an r.m.s.d. of 1.0 is shown as gray mesh. The representation and alignment were obtained using PyMOL 2.3.0 (Schrödinger) and the align command with cycles=0.
[Figure 5]
Figure 5
Possible alternative interface facilitated by a symmetry mate in the crystal structure of RBP-CPC. (a) Cartoon representation of the interface of chain A and the participating elements of its symmetry mate chain A′ in the crystal structure of RBP-CPC. The termini of the protein and the gap where the chain could not be traced are labeled for each chain. (b) Cartoon representation of the interface of the RBP-CPN dimer. Secondary structures are labeled according to Fig. 1[link].

The case is different when looking at the N-terminal lobe. The crystal structure of RBP-CPN was solved in the monoclinic space group P21 at 1.79 Å resolution. The asymmetric unit is composed of four chains, of which two pairs form a dimer via a segment swap. Unlike the interface of the two lobes in native PBPs, the dimer is located on the edge of the two central β-sheets (Fig. 4[link]b). This extension of the sheet is mediated via each of the respective βE strands. In contrast to the rest of the central β-sheet, the two βE strands form an antiparallel stretch of the extended β-sheet. This change in direction of the C-terminal β-strand is not known to occur in PBP-like fold type I proteins, in which the central β-sheet always adopts a parallel conformation. In addition, this swap of the βDβE elements in their parallel–antiparallel arrangement forms the interface of the dimer (Fig. 1[link]d). These structural rearrangements are also reflected by the significant difference in r.m.s.d. of 5.9 Å when comparing the structure of RBP-CPN with the equivalent half of the full-length RBP (Fig. 4[link]d). This unusual rearrangement of elements indicates a high tolerance of this structural motif to variations in its topology. In agreement with other structures, such as the CheY-like fold (Paithankar et al., 2019[Paithankar, K. S., Enderle, M., Wirthensohn, D. C., Miller, A., Schlesner, M., Pfeiffer, F., Rittner, A., Grininger, M. & Oesterhelt, D. (2019). Acta Cryst. F75, 576-585.]), the TIM-barrel fold (Michalska et al., 2020[Michalska, K., Kowiel, M., Bigelow, L., Endres, M., Gilski, M., Jaskolski, M. & Joachimiak, A. (2020). Acta Cryst. D76, 166-175.]) and other related folds (Lewis et al., 2000[Lewis, R. J., Muchová, K., Brannigan, J. A., Barák, I., Leonard, G. & Wilkinson, A. J. (2000). J. Mol. Biol. 297, 757-770.]; Tran et al., 2021[Tran, L. H., Urbanowicz, A., Jasiński, M., Jaskolski, M. & Ruszkowski, M. (2021). Front. Plant Sci. 12, 756341.]; Szilágyi et al., 2017[Szilágyi, A., Györffy, D. & Závodszky, P. (2017). Proteins, 85, 46-53.]), the isolated domains of a PBP-like type I protein show a high degree of malleability.

4. Conclusions

The obtained crystal structures of the permuted constructs of both the N- and C-terminal lobes of RBP from T. maritima suggest the possibility that they could have existed in isolation of the full structural context. This corresponds to the idea that modern PBPs arose from a duplication event. Based on structural and sequence similarities, it has been proposed that this progenitor was an ancestral protein of the flavodoxin-like fold. The existence of the stable permuted halves clearly shows that the single lobe can exist on its own and can help inform on this evolutionary process.

However, the observed swapping of elements in RBP-CPN could also correspond to another event in the evolution of PBPs. It has previously been concluded that the evolution of the PBP-like fold involved domain swapping of the C-terminal helices, a step that was necessary to generate the characteristic hinge-bending motion of PBPs, with subsequent fusion of this proposed ancestral dimer (Fukami-Kobayashi et al., 1999[Fukami-Kobayashi, K., Tateno, Y. & Nishikawa, K. (1999). J. Mol. Biol. 286, 279-290.]). In addition, it has been proposed that the absence of the helix between β-strands D and E and helix 8 (Fig. 1[link]b) may have been a necessary step for the swapping event that led to PBPs with the type II fold. This partially explains why we observe a dimer with an unusual segment swap in RBP-CPN, which lacks this helix. However, it appears that RBP-CPC, which still contains this corresponding helix 8, does not reliably form a dimer. However, the alternative interface involving the chain from a symmetry mate could partially explain the behavior observed in SEC-MALS measurements. The dynamic shift to higher molecular weight species can only be observed at high protein concentrations. Interestingly, however, the antiparallel stretch of residues 117′–119′ in RBP-CPC bears a resemblance to the continuation of the central β-sheet in RBP-CPN. The residues participating in the interaction with β4 are the additional residues introduced via the design. A reason for this could be the energetically frustrated surface of β4, which now lacks the corresponding β5 from RBP, that induces the switch of the designed loop into a more strand-like conformation to satisfy this hydrophobic surface.

Alternatively, a possible explanation may lie in the folding pathway of proteins with a flavodoxin-like fold. The folding mechanism of CheY, a well studied protein with a flavodoxin-like fold, suggests that there may be a universal subdomain intermediate in the folding pathway (Hills & Brooks, 2008[Hills, R. D. Jr & Brooks, C. L. III (2008). J. Mol. Biol. 382, 485-495.]). The N-terminal β1–3α1–2 elements appear to initially form a central triad followed by folding of the remaining elements. The permuted RBP lobes could follow a similar path. The corresponding elements could form a folded scaffold onto which the rest of the protein folds. This substructure potentially stabilizes the protein to a point where the C-terminal elements can still adapt a structured conformation but provide sufficient flexibility for the unusual rearrangement that we have found.

The novel antiparallel stretch of the dimer-swapped β-sheets has not been observed before in proteins with the type I PBP-like fold, and the existence of this swap highlights the flexibility of this structural element. Additionally, the alleviation of the energetically frustrated hydrophobic surface achieved via the alternative interface in the structure of RBP-CPC could offer valuable insights into the mechanisms behind domain swapping in PBPs in general. More detailed sequence analysis and experiments would be required to obtain a clear picture of the transition from type I to type II PBPs. The malleability of this α/β architecture, which is also apparent in other folds (for example the Rossmann, flavodoxin and TIM-barrel-like folds), may be a reason for its frequent occurrence in modern proteins (Ferruz et al., 2021[Ferruz, N., Michel, F., Lobos, F., Schmidt, S. & Höcker, B. (2021). Front. Mol. Biosci. 8, 715972.]).

Supporting information


Acknowledgements

We acknowledge the allocation of synchrotron beamtime and financial support by HZB and thank the beamline staff at BESSY for support. The authors declare that they have no known competing financial interests or personal relationships that could have influenced the work reported in this paper. We thank all members of the Höcker Laboratory for their constructive suggestions to improve the research. Open access funding enabled and organized by Projekt DEAL.

Funding information

This work was supported by the European Research Council (ERC Consolidator Grant 647548 `Protein Lego' to BH), the VolkswagenStiftung (grant 94747 to BH) and by a fellowship from the Alexander von Humboldt and Bayer Science and Education Foundations (Humboldt–Bayer Research Fellowship for Postdoctoral Researchers to SRR).

References

First citationAfonine, P. V., Poon, B. K., Read, R. J., Sobolev, O. V., Terwilliger, T. C., Urzhumtsev, A. & Adams, P. D. (2018). Acta Cryst. D74, 531–544.  Web of Science CrossRef IUCr Journals Google Scholar
First citationBennett, M. J., Schlunegger, M. P. & Eisenberg, D. (1995). Protein Sci. 4, 2455–2468.  CrossRef CAS PubMed Web of Science Google Scholar
First citationBerman, H. M., Battistuz, T., Bhat, T. N., Bluhm, W. F., Bourne, P. E., Burkhardt, K., Feng, Z., Gilliland, G. L., Iype, L., Jain, S., Fagan, P., Marvin, J., Padilla, D., Ravichandran, V., Schneider, B., Thanki, N., Weissig, H., Westbrook, J. D. & Zardecki, C. (2002). Acta Cryst. D58, 899–907.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationChandravanshi, M., Tripathi, S. K. & Kanaujia, S. P. (2021). FEBS Lett. 595, 2395–2409.  CrossRef PubMed Google Scholar
First citationCuneo, M. J., Beese, L. S. & Hellinga, H. W. (2008). BMC Struct. Biol. 8, 50.  Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFelder, C. B., Graul, R. C., Lee, A. Y., Merkle, H. P. & Sadee, W. (1999). AAPS PharmSci, 1, E2.  Google Scholar
First citationFerruz, N., Michel, F., Lobos, F., Schmidt, S. & Höcker, B. (2021). Front. Mol. Biosci. 8, 715972.  CrossRef PubMed Google Scholar
First citationFukami-Kobayashi, K., Tateno, Y. & Nishikawa, K. (1999). J. Mol. Biol. 286, 279–290.  Web of Science CAS PubMed Google Scholar
First citationGabadinho, J., Beteva, A., Guijarro, M., Rey-Bakaikoa, V., Spruce, D., Bowler, M. W., Brockhauser, S., Flot, D., Gordon, E. J., Hall, D. R., Lavault, B., McCarthy, A. A., McCarthy, J., Mitchell, E., Monaco, S., Mueller-Dieckmann, C., Nurizzo, D., Ravelli, R. B. G., Thibault, X., Walsh, M. A., Leonard, G. A. & McSweeney, S. M. (2010). J. Synchrotron Rad. 17, 700–707.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationGreenfield, N. J. (2006). Nat. Protoc. 1, 2876–2890.  CrossRef PubMed Google Scholar
First citationHennecke, J., Sebbel, P. & Glockshuber, R. (1999). J. Mol. Biol. 286, 1197–1215.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHills, R. D. Jr & Brooks, C. L. III (2008). J. Mol. Biol. 382, 485–495.  CrossRef PubMed Google Scholar
First citationHöcker, B. (2014). Curr. Opin. Struct. Biol. 27, 56–62.  Web of Science PubMed Google Scholar
First citationHuang, P.-S., Ban, Y.-E. A., Richter, F., Andre, I., Vernon, R., Schief, W. R. & Baker, D. (2011). PLoS One, 6, e24109.  CrossRef PubMed Google Scholar
First citationHuang, Y.-M., Nayak, S. & Bystroff, C. (2011). Protein Sci. 20, 1775–1780.  CrossRef PubMed Google Scholar
First citationIwakura, M., Nakamura, T., Yamane, C. & Maki, K. (2000). Nat. Struct. Biol. 7, 580–585.  CrossRef PubMed Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKrissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774–797.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLaskowski, R. A., Jabłońska, J., Pravda, L., Vařeková, R. S. & Thornton, J. M. (2018). Protein Sci. 27, 129–134.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLewis, R. J., Muchová, K., Brannigan, J. A., Barák, I., Leonard, G. & Wilkinson, A. J. (2000). J. Mol. Biol. 297, 757–770.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLouie, G. V. (1993). Curr. Opin. Struct. Biol. 3, 401–408.  CrossRef CAS Web of Science Google Scholar
First citationMalý, M., Diederichs, K., Dohnálek, J. & Kolenko, P. (2020). IUCrJ, 7, 681–692.  Web of Science CrossRef PubMed IUCr Journals Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMichalska, K., Kowiel, M., Bigelow, L., Endres, M., Gilski, M., Jaskolski, M. & Joachimiak, A. (2020). Acta Cryst. D76, 166–175.  Web of Science CrossRef IUCr Journals Google Scholar
First citationMueller, U., Förster, R., Hellmig, M., Huschmann, F. U., Kastner, A., Malecki, P., Pühringer, S., Röwer, M., Sparta, K., Steffien, M., Ühlein, M., Wilk, P. & Weiss, M. S. (2015). Eur. Phys. J. Plus, 130, 141–151.  CrossRef Google Scholar
First citationOhta, T. (2000). Philos. Trans. R. Soc. London B, 355, 1623–1626.  CrossRef Google Scholar
First citationPaithankar, K. S., Enderle, M., Wirthensohn, D. C., Miller, A., Schlesner, M., Pfeiffer, F., Rittner, A., Grininger, M. & Oesterhelt, D. (2019). Acta Cryst. F75, 576–585.  Web of Science CrossRef IUCr Journals Google Scholar
First citationRomero-Romero, S., Kordes, S., Michel, F. & Höcker, B. (2021). Curr. Opin. Struct. Biol. 68, 94–104.  PubMed Google Scholar
First citationScheepers, G. H., Lycklama a Nijeholt, J. A. & Poolman, B. (2016). FEBS Lett. 590, 4393–4401.  Google Scholar
First citationSikosek, T. & Chan, H. S. (2014). J. R. Soc. Interface, 11, 20140419.  CrossRef PubMed Google Scholar
First citationSparta, K. M., Krug, M., Heinemann, U., Mueller, U. & Weiss, M. S. (2016). J. Appl. Cryst. 49, 1085–1092.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationSzilágyi, A., Györffy, D. & Závodszky, P. (2017). Proteins, 85, 46–53.  PubMed Google Scholar
First citationToledo-Patiño, S., Chaubey, M., Coles, M. & Höcker, B. (2019). Biochemistry, 58, 4790–4793.  PubMed Google Scholar
First citationTran, L. H., Urbanowicz, A., Jasiński, M., Jaskolski, M. & Ruszkowski, M. (2021). Front. Plant Sci. 12, 756341.  CrossRef PubMed Google Scholar
First citationZwart, P. H., Grosse-Kunstleve, R. W. & Adams, P. D. (2005). CCP4 Newsl. Protein Crystallogr. 43, contribution 7.  Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL
BIOLOGY
ISSN: 2059-7983
Follow Acta Cryst. D
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds