structural communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Volume 70| Part 10| October 2014| Pages 1318-1323

Structure of a short-chain de­hydrogenase/reductase (SDR) within a genomic island from a clinical strain of Acinetobacter baumannii

CROSSMARK_Color_square_no_text.svg

aDepartment of Chemistry and Biomolecular Sciences, Macquarie University, Research Park Drive, Sydney, NSW 2109, Australia, and bSchool of Physics, University of New South Wales, Sydney, NSW 2052, Australia
*Correspondence e-mail: [email protected]

(Received 4 July 2014; accepted 2 September 2014; online 25 September 2014)

Over 15% of the genome of an Australian clinical isolate of Acinetobacter baumannii occurs within genomic islands. An uncharacterized protein encoded within one island feature common to this and other International Clone II strains has been studied by X-ray crystallography. The 2.4 Å resolution structure of SDR-WM99c reveals it to be a new member of the classical short-chain dehydrogenase/reductase (SDR) superfamily. The enzyme contains a nucleotide-binding domain and, like many other SDRs, is tetrameric in form. The active site contains a catalytic tetrad (Asn117, Ser146, Tyr159 and Lys163) and water molecules occupying the presumed NADP cofactor-binding pocket. An adjacent cleft is capped by a relatively mobile helical subdomain, which is well positioned to control substrate access.

1. Introduction

The opportunistic pathogen Acinetobacter baumannii is a Gram-negative coccobacillus responsible for both community-acquired and nosocomial infections and is of growing concern owing to the recent emergence of multidrug-resistant forms (Towner, 2009[Towner, K. J. (2009). J. Hosp. Infect. 73, 355-363.]; Visca et al., 2011[Visca, P., Seifert, H. & Towner, K. J. (2011). IUBMB Life, 63, 1048-1054.]). Colonization appears to be phenotypically associated with inherent systems for exopolysaccharide production, pilus formation and iron sequestration (Iwashkiw et al., 2012[Iwashkiw, J. A., Seper, A., Weber, B. S., Scott, N. E., Vinogradov, E., Stratilo, C., Reiz, B., Cordwell, S. J., Whittal, R., Schild, S. & Feldman, M. F. (2012). PLoS Pathog. 8, e1002758.]; Peleg et al., 2008[Peleg, A. Y., Seifert, H. & Paterson, D. L. (2008). Clin. Microbiol. Rev. 21, 538-582.]), but specific virulence mechanisms remain poorly described (Durante-Mangoni & Zarrilli, 2011[Durante-Mangoni, E. & Zarrilli, R. (2011). Future Microbiol. 6, 407-422.]). Full sequencing of several A. baumannii isolates (Ramírez et al., 2013[Ramírez, M. S., Vilacoba, E., Stietz, M. S., Merkier, A. K., Jeric, P., Limansky, A. S., Márquez, C., Bello, H., Catalano, M. & Centrón, D. (2013). Curr. Microbiol. 67, 9-14.]; Farrugia et al., 2013[Farrugia, D. N., Elbourne, L. D., Hassan, K. A., Eijkelkamp, B. A., Tetu, S. G., Brown, M. H., Shah, B. S., Peleg, A. Y., Mabbutt, B. C. & Paulsen, I. T. (2013). PLoS One, 8, e58628.]; Liou et al., 2012[Liou, M.-L., Liu, C.-C., Lu, C.-W., Hsieh, M.-F., Chang, K.-C., Kuo, H.-Y., Lee, C.-C., Chang, C.-T., Yang, C.-Y. & Tang, C. Y. (2012). J. Bacteriol. 194, 6974.]) has recently highlighted an extraordinary genetic plasticity, with genomic islands (GIs) contributing significantly to diversity of strains. These are identifiable as discrete clusters of laterally acquired DNA segments incorporating factors for chromosomal integration, excision or transfer (Farrugia et al., 2013[Farrugia, D. N., Elbourne, L. D., Hassan, K. A., Eijkelkamp, B. A., Tetu, S. G., Brown, M. H., Shah, B. S., Peleg, A. Y., Mabbutt, B. C. & Paulsen, I. T. (2013). PLoS One, 8, e58628.]). GI features (occasionally termed resistance or pathogenicity islands) are well defined contributors to bacterial evolution, disseminating variable genes influencing niche adaptation and virulence, as well as catabolic genes for new metabolic pathways (Juhas et al., 2009[Juhas, M., van der Meer, J. R., Gaillard, M., Harding, R. M., Hood, D. W. & Crook, D. W. (2009). FEMS Microbiol. Rev. 33, 376-393.]).

A draft genome sequence of the Australian strain A. baumannii WM99c, isolated from a hospital patient in Sydney (Valenzuela et al., 2007[Valenzuela, J. K., Thomas, L., Partridge, S. R., van der Reijden, T., Dijkshoorn, L. & Iredell, J. (2007). J. Clin. Microbiol. 45, 453-460.]), has recently been described (Eijkelkamp et al., 2011[Eijkelkamp, B. A., Stroeher, U. H., Hassan, K. A., Papadimitrious, M. S., Paulsen, I. T. & Brown, M. H. (2011). FEMS Microbiol. Lett. 323, 44-51.]). At the time of sequencing, our multi-way BLAST analysis identified 20 GIs, accounting for 16% of the WM99c genome. One island of interest (GI_12, encompassing 11 ORFs) recurs in its entirety across all known A. baumannii genomes of the International Clone II (IC-II) lineage, regardless of geographic origin (Daniel Farrugia, personal communication).

The island GI_12 encodes (amongst a group of other enzymes) a permease, a transcriptional regulator and an aminoglycoside phosphotransferase (see Fig. 1[link]). Here, we describe the 2.4 Å resolution crystal structure determined for SDR-WM99c, one of a pair of hypothetical proteins also encoded within this island. Its structure displays a tertiary fold attributable to a short-chain dehydrogenase (SDR) of classical architecture (Kavanagh et al., 2008[Kavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895-3906.]). The relatively large SDR family catalyses a broad range of reactions utilizing NAD(P)-dinucleotide cofactors (Kallberg et al., 2002[Kallberg, Y., Oppermann, U., Jörnvall, H. & Persson, B. (2002). Eur. J. Biochem. 269, 4409-4417.]). This robust enzyme fold is known to accommodate a wide variety of substrates and thus yields metabolic functions spanning several EC classes from oxidoreductases and lyases to isomerases (Jörnvall et al., 2010[Jörnvall, H., Hedlund, J., Bergman, T., Oppermann, U. & Persson, B. (2010). Biochem. Biophys. Res. Commun. 396, 125-130.]).

[Figure 1]
Figure 1
Crystal structure of SDR-WM99c dehydrogenase (apoenzyme form) solved to 2.4 Å resolution (PDB entry 4iuy ). (a) The genetic organization of the A. baumannii GI_12w genomic island encompassing 11 genes. The WM99c gene encoding the SDR-WM99c protein is shaded. Horizontal arrows show the direction of transcription. (b) The tetrameric assembly of SDR-WM99c, with chain A shown in red, chain B in green, chain C in yellow and chain D in blue, demonstrates two major inter-subunit interfaces (A–­B and A–­D). (c) A single chain of SDR-WM99c coloured by secondary structure illustrates the three-layered α/β structure with a seven-stranded β-sheet. A helical motif (helices α′ and α′′) caps the C-terminal edge of the sheet and displays some conformational mobility.

This crystal structure defines a new SDR member apparently characteristic to A. baumannii. It recurs with identical sequence within GIs from at least 17 distinct strains of the organism, regardless of clonal lineage. Some sequence relatives for this SDR can be discerned in genomes of Hydrocarboniphaga effusa (sequence identity 51%), Marinobacter sp. (52%) and Limnobacter sp. (47%).

2. Materials and methods

2.1. Cloning, expression and purification of SDR-WM99c

The gene for SDR-WM99c was PCR-amplified using genomic DNA extracted from A. baumannii strain WM99c (Jon Iredell, Westmead Clinical School, Australia). Ligation-independent cloning into vector pET-15b was accomplished using BamHI and NdeI restriction sites for expression of SDR-WM99c with an N-terminal His6 tag (see Table 1[link]). Following transformation, Escherichia coli BL21 (DE3) pLysS cells (Sigma–Aldrich) were grown at 37°C in selenomethionine medium (M9 kit, Medicilon, Shanghai, People's Republic of China) until an optical density at 600 nm (OD600) of 1.2–1.3 was reached. Recombinant protein expression was induced with 1 mM IPTG and the cells were grown overnight with shaking.

Table 1
Macromolecule-production information

Source organism A. baumannii (strain WM99c)
DNA source A. baumannii (strain WM99c)
Forward primer GCGCGGCAGCCATATGAATATTTTTGATGTAAAAG
Reverse primer GTTAGCAGCCGGATCCTTATATAGGCGCAGC
Cloning vector pET-15
Expression vector pET-15
Expression host E. coli BL21 (DE3) pLysS
Complete amino-acid sequence of the construct produced MGSSHHHHHHSSGLVPRGSMNIFDVKDKYILITGASSGLGHHIAELFAKEGANIVICARRLERLKELESHIKNEYGVQVYTFALDVNDRSAVKDMLSSLEAEGVTIDVLINNAGVSDTKRFLDYNDEDWDKIVDTNLKAPWQCAQEVVQHMIKAERKGSIINITSILSQSTNLGVSPYCASKAGLRHLTEVMAVELARFGINVNAIAPGYMITEINEEYLTSEVGQQLLKKIPTRKFVEFDDLNGPLLLLASQAGQGITGIEIKVDGGHSAAPI

Cells were harvested (5000g, 30 min) and resuspended in buffer A (50 mM HEPES buffer pH 7.5, 500 mM NaCl) with 5 mM imidazole. Cells were lysed by freeze–thawing and sonication on ice. Following centrifugation (20 000g, 30 min), the clarified lysate (30 ml) was loaded onto a pre-packed Ni–NTA column (1 ml; GE Healthcare) equilibrated in buffer A with 5 mM imidazole operating under a peristaltic pump (20°C). Protein product was eluted by competing adsorbent with buffer A with 500 mM imidazole. After addition of 1 mM EDTA, the collected SDR-WM99c fraction was dialyzed into 50 mM HEPES buffer pH 7.5 with 300 mM NaCl and frozen. The reducing reagent tris-(2-carboxyethyl)phosphine (TCEP) at 0.5 mM and glycerol at 5%(v/v) were additives in all buffers.

The purity of the recombinant product was verified using SDS–PAGE, which showed a single band of 30 kDa. A native mass of 120 kDa was determined for SDR-WM99c by size-exclusion chromatography (SEC) on a Superdex G200 10/300 column in 50 mM HEPES buffer pH 7.5, 300 mM NaCl, 5%(v/v) glycerol.

2.2. Crystallization and data collection

Aliquots (0.5–1 µl) of SDR-WM99c (27 mg ml−1) were subjected to a sparse-matrix crystal screen (MCSG-1; Microlytic North America) with a Phoenix robot using the sitting-drop format. Optimization was conducted in hanging-drop format (2 µl) in a 24-well grid with 1:1 and 1:2 (protein:reservoir) conditions (see Table 2[link]). The best diffracting crystals of SDR-WM99c were obtained at 4°C in 0.14 M ammonium sulfate, 0.1 M HEPES buffer pH 7.5, 18.65%(v/v) PEG 3350 (crystal 1) and 0.16 M ammonium sulfate, 0.1 M HEPES buffer pH 7.5, 20%(v/v) PEG 3350 (crystal 2). Prior to flash-cooling for data collection, crystals were soaked in mother liquor supplemented with 20%(v/v) glycerol for 25 min (crystal 1) or 10 min (crystal 2) and cryocooled.

Table 2
Crystallization

  Crystal 1 Crystal 2
Method Vapour diffusion, sitting drop Vapour diffusion, sitting drop
Plate type 24-well (Cryschem plate, Hampton Research) 24-well (Cryschem plate, Hampton Research)
Temperature (K) 277 277
Protein concentration (mg ml−1) 27 27
Buffer composition of protein solution 50 mM HEPES buffer pH 7.5, 300 mM NaCl, 0.5 mM TCEP, 5%(v/v) glycerol 50 mM HEPES buffer pH 7.5, 300 mM NaCl, 0.5 mM TCEP 5%(v/v) glycerol
Composition of reservoir solution 0.14 M ammonium sulfate, 0.1 M HEPES pH 7.5, 18.65%(v/v) PEG 3350 0.16 M ammonium sulfate, 0.1 M HEPES pH 7.5, 20%(v/v) PEG 3350
Volume and ratio of drop 2 µl and 1:1 (protein:reservoir) 2 µl and 1:2 (protein:reservoir)
Volume of reservoir (µl) 500 500

X-ray data were recorded on the MX1 beamline at the Australian Synchrotron (Melbourne) using the Blu-Ice software (McPhillips et al., 2002[McPhillips, T. M., McPhillips, S. E., Chiu, H.-J., Cohen, A. E., Deacon, A. M., Ellis, P. J., Garman, E., Gonzalez, A., Sauter, N. K., Phizackerley, R. P., Soltis, S. M. & Kuhn, P. (2002). J. Synchrotron Rad. 9, 401-406.]). Reflections were measured on an ADSC Quantum 210r Detector (ADSC, Poway, USA) at a wavelength of 0.9537 Å (13 000.5 eV). For crystal 1, multi-wavelength anomalous dispersion (MAD) data sets were additionally collected. Full data-collection statistics for both crystal 1 and crystal 2 are given in Table 3[link].

Table 3
Data-collection and structure-solution statistics

Values in parentheses are for the outer shell.

  Crystal 1 Crystal 2
Wavelength (Å) 0.9537 0.9794 0.9537
Rotation range per image (°) 0.5 0.5 0.5
Total rotation range (°) 360 360 720
Exposure time per image (s) 1 1 2
Space group P1211 P1211 P1211
a, b, c (Å) 106.0, 89.1, 121.1 106.0, 89.1, 121.1 106.2, 89.53, 120.9
α, β, γ (°) 90, 112.70, 90 90, 112.70, 90 90, 112.69, 90
Resolution (Å) 19.75–2.38 (2.51–2.38) 19.86–2.45 (2.59–2.45) 19.76–2.38 (2.51–2.38)
No. of unique reflections 80229 (9729) 73908 (9199) 81772 (10613)
Completeness (%) 96.2 (80.5) 96.8 (82.8) 98 (87.8)
Multiplicity 3.7 (2.9) 3.7 (2.9) 7.3 (5.8)
Mean I/σ(I) 10.5 (0.9) 10.8 (1.2) 15.6 (1.8)
Rmerge (%) 0.082 (1.078) 0.078 (0.825) 0.087 (0.927)
CC1/2 0.997 (0.462) 0.997 (0.541) 0.999 (0.719)
Anomalous completeness (%) 90.4 (61.5) 91.1 (63.9) 93.3 (57.3)
Anomalous multiplicity 1.9 (1.7) 1.9 (1.7) 3.8 (3.6)
CCanom 0.174 (0.044) 0.461 (0.013) 0.443 (0.037)

2.3. Structure determination

Diffraction data were indexed, integrated and scaled with XDS (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]). Owing to its low sequence identity with the SDR structure family, as well as the weak anomalous scattering of the crystals, solution of the SDR-WM99c structure required a combination of molecular replacement (MR) and single-wavelength anomalous diffraction (SAD). At a lower X-ray dose of 1 s per image, data collected from crystal 1 proved useful to collect the anomalous signal required for calculation of the initial model. Crystal 2 was exposed to a higher X-ray dose (2 s per image), resulting in a comparatively lower anomalous signal but a higher resolution, redundancy and completeness suitable for further refinement. The anomalous scattering of both crystals was not strong enough for utilization of the MAD method to locate the large number of incorporated Se heavy atoms. The space group was determined to be P1211 and the asymmetric unit contained eight protein chains with 46% solvent (Matthews coefficient of 2.3 Å3 Da−1).

A molecular-replacement substructure was obtained with Phaser MR (McCoy, 2007[McCoy, A. J. (2007). Acta Cryst. D63, 32-41.]) from the CCP4 suite (Winn et al., 2011[Winn, M. D. et al. (2011). Acta Cryst. D67, 235-242.]) using the structure of the Salmonella enterica putative hexonate dehydrogenase (PDB entry 4g81 ; 35% sequence identity) as a model. The phases from MR and SAD were combined using Phaser EP (SAD with molecular-replacement partial structure; McCoy, 2007[McCoy, A. J. (2007). Acta Cryst. D63, 32-41.]). During this MR/SAD pipeline, 40 Se sites were identified in each asymmetric unit. This was followed by density improvement in Parrot (Cowtan, 2010[Cowtan, K. (2010). Acta Cryst. D66, 470-478.]) to yield a preliminary model with 1934 residues. The final model was obtained after several rounds of refinement using phenix.refine (Afonine et al., 2012[Afonine, P. V., Grosse-Kunstleve, R. W., Echols, N., Headd, J. J., Moriarty, N. W., Mustyakimov, M., Terwilliger, T. C., Urzhumtsev, A., Zwart, P. H. & Adams, P. D. (2012). Acta Cryst. D68, 352-367.]) in PHENIX (Adams et al., 2010[Adams, P. D. et al. (2010). Acta Cryst. D66, 213-221.]) and manual model building in Coot (Emsley & Cowtan, 2004[Emsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126-2132.]). The overall stereochemical quality of the final model was assessed using MolProbity (Chen et al., 2010[Chen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12-21.]) and the ADIT validation server (https://deposit.pdb.org/validate/ ). Structural homologues were identified with DALI searches (Holm & Rosenström, 2010[Holm, L. & Rosenström, P. (2010). Nucleic Acids Res. 38, W545-W549.]) as at March, 2014. The coordinates for the final model have been deposited in the Protein Data Bank (PDB entry 4iuy ).

3. Results and discussions

3.1. Structure determination

The structure of SDR-WM99c was refined to 2.4 Å resolution with an R factor of 15.6% and an Rfree of 20.4%. The enzyme crystallized in the apo form, with no cofactor or substrate bound in any subunit. The final model contains 531 water molecules in each asymmetric unit. All eight chains can be completely traced from residues 2 to 254 (a total chain length of 255 residues). Electron density for the 19-residue His6 purification tag was not visible. In all chains, the sole Ramachandran outlier was Ser146 (φ = 170.6–173.5°, ψ = 150.9–152.1°). This specific residue is proposed to be part of the active site and a participant in the proton-relay system (see §[link]3.3). Comparable distortion of active-site serine residues has been noted previously in cofactor-bound and apo forms of several SDR enzymes (Mycobacterium marinum, PDB entry 3r1i , Seattle Structural Genomics Center for Infectious Disease, unpublished work; Synechococcus elongatus, PDB entry 4dmm , C. Chen, N. N. Zhuang & K. H. Lee, unpublished work; Rhodobacter sphaeroides, PDB entry 1k2w , Philippsen et al., 2005[Philippsen, A., Schirmer, T., Stein, M. A., Giffhorn, F. & Stetefeld, J. (2005). Acta Cryst. D61, 374-379.]).

The crystalline packing shows that the eight subunits of each asymmetric unit are organized as two homotetramers: ABCD (see Fig. 1[link]b) and EFGH. All eight chains align closely, with an r.m.s.d. of 0.3–0.5 Å (Cα atoms). Overall, the tetrameric unit ABCD displays lower B-factor values (see Table 4[link]). In solution, the native mass determined for SDR-WM99c was consistent with a stable tetramer, and no dimeric population was evident in elution traces.

Table 4
Structure refinement and model validation

Values in parentheses are for the outer shell.

Resolution (Å) 19.76–2.38 (2.4450–2.385)
σ Cutoff F > 1.34σ(F)
No. of reflections, working set 81728 (4265)
No. of reflections, test set 1993 (91)
Final Rcryst 0.155 (0.2812)
Final Rfree 0.203 (0.3959)
No. of protein residues 2025
No. of atoms
 Total 16196
 Protein 15665
 Solvent 531
TLS groups 32
R.m.s.d. from standard values
 Bond lengths (Å) 0.008
 Bond angles (°) 1.15
Average B factor (Å2)
 Chain A (main chain/side chain) 59.9/65.6
 Chain B (main chain/side chain) 56.2/63.5
 Chain C (main chain/side chain) 52.9/59.2
 Chain D (main chain/side chain) 59.0/67.5
 Chain E (main chain/side chain) 79.6/85.8
 Chain F (main chain/side chain) 82.6/88.1
 Chain G (main chain/side chain) 66.2/73.3
 Chain H (main chain/side chain) 81.5/88.2
 Solvent 57.7
Ramachandran plot (%)
 Favoured regions 97
 Allowed regions 2.9
 Outliers 0.1
PDB code 4iuy

3.2. SDR-WM99c is a classical SDR enzyme

The fold determined for SDR-WM99c is illustrated in Fig. 1[link]. Its central parallel β-sheet (strands β1–β7) is surrounded on each side by two groups of α-helices (α1, α2, α6 and α3, α4, α5). Thus, the overall fold is characteristic of the SDR enzyme superfamily (Kallberg et al., 2002[Kallberg, Y., Oppermann, U., Jörnvall, H. & Persson, B. (2002). Eur. J. Biochem. 269, 4409-4417.]), incorporating a nucleotide-binding Rossmann fold (Rossmann et al., 1974[Rossmann, M. G., Moras, D. & Olsen, K. W. (1974). Nature (London), 250, 194-199.]). The αβα core is extended in the case of SDR-WM99c by a capping helix–turn–helix feature (helices α′ and α′′; Asn197–Ile213). A small 310-helix at the C-terminus makes contact with this capping element. Helices α′ and α′′ display relatively high B factors (ranging from 146 to 203 Å2), indicating dynamic mobility in this region. As observed across SDR structures (Filling et al., 2002[Filling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677-25684.]), a carbonyl group within helix α4 (here, Asn117) ligates to a solvent molecule of the catalytic relay, thus resulting in a characteristic helical kink.

With the structure of SDR-WM99c solved, a search for structural homologues indicates strong alignment with several members of the classical SDR family. The high degree of structural conservation across this family is seen in Fig. 2[link]: the closest relatives include an uncharacterized dehydrogenase from Salmonella enterica (PDB entry 4g81 ; Enzyme Function Initiative, unpublished work), FabG1 or 13-oxoacyl-(acyl carrier protein) reductase from Staphylococcus aureus (PDB entry 3sj7 ; Dutta et al., 2012[Dutta, D., Bhattacharyya, S. & Das, A. K. (2012). Proteins, 80, 1250-1257.]) and SDH, a sorbitol dehydrogenase from R. sphaeroides (PDB entry 1k2w ; Philippsen et al., 2005[Philippsen, A., Schirmer, T., Stein, M. A., Giffhorn, F. & Stetefeld, J. (2005). Acta Cryst. D61, 374-379.]). FabG1 is involved in fatty-acid synthesis, whereas the SDH enzyme catalyses the dehydrogenation of sugars, with preference for the substrate pair sorbitol/D-fructose. The most marked differences between members of this SDR subgroup arise from variation in the structural arrangement, length and flexibility of the capping helical region (i.e. helices α′ and α′′).

[Figure 2]
Figure 2
Structure of SDR-WM99c (pink) overlaid with its seven closest structural homologues: 3-oxoacyl-(ACP) reductase (S. aureus FabG1; PDB entry 3sj7 ; cyan), S. enterica dehydrogenase (PDB entry 4g81 ; pale red), 3-oxoacyl-(ACP) reductase (Synechococcus elongatus FabG2; PDB entry 4dmm ; pale green), 3-oxoacyl-(ACP) reductase (S. aureus FabG3; PDB entry 3osu ; pale blue), M. marinum SDR (PDB entry 3r1i ; pale yellow), sorbitol dehydrogenase (Rhodobacter sphaeroides; PDB entry 1k2w ; pale orange) and oestradiol 17-β-dehydrogenase (PDB entry 2pd6 ; blue white). The r.m.s.d. is 1.3–1.5 Å over all Cα atoms. Inset: magnification of the proposed catalytic side chains Asn117, Ser146, Tyr159 and Lys163 indicates close alignment of the active-site residues. The depicted NADP model is derived from a FabG1 (PDB entry 3sj7 ) ligand-bound crystal structure.

3.3. Insights into cofactor preference and mechanism of SDR-WM99c

For catalysis, most SDRs depend on a set of four highly conserved active-site features: a serine/threonine, an asparagine and an invariant Tyr-x3-Lys motif (Filling et al., 2002[Filling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677-25684.]). Overlay of SDR-WM99c and its closely related SDR structures (Fig. 2[link]) immediately reveals retention of the geometry of side chains for this catalytic tetrad. These four active-site residues are thereby identified in SDR-WM99c as Asn117 (α4), Ser146 (β5–α6 loop), Tyr159 (α5) and Lys163 (α5).

Classical SDR enzymes utilize NADP as a cofactor in catalysis (Filling et al., 2002[Filling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677-25684.]). No density consistent with either cofactor or substrate was evident within this structure of SDR-WM99c; however, overlay with the structure of the related FabG1–NADP complex clearly reveals the cofactor site. Fig. 3[link] depicts a close view of this region within SDR-WM99c, showing that several water molecules occupy this proposed site for cofactor binding. In the FabG1–NADP structure, the following contacts are documented (Dutta et al., 2012[Dutta, D., Bhattacharyya, S. & Das, A. K. (2012). Proteins, 80, 1250-1257.]): the adenine group located near the α4 helix (interacting with Asn60 and Val61), the ribose phosphate surrounded by the β1–α1 loop (Thr8, Gly9 and Arg12) and the nicotinamide moiety stabilized by catalytic residues Tyr152 and Lys156, as well as the β4–α4 loop (Asn87, Ala88). By direct analogy, in SDR-WM99c the adenine ring and the ribose phosphate are proposed to engage α4 helix residues (Asp66 and Val67) and β1–α1 loop residues (Thr14, Gly15 and Ser17), respectively. Additionally, the proposed catalytic residues Tyr159 and Lys163, as well as the β4–α4 loop (Asn93 and Ala94), are well positioned in SDR-WM99c to engage the nicotinamide moiety.

[Figure 3]
Figure 3
Stereoview of the catalytic site of SDR-WM99c. The active site of SDR-WM99c (pink) modelled with NADP (cyan; superposed from PDB entry 3sj7 ). Side chains are depicted for active sites from SDR-WM99c (pink) and S. aureus FabG1 (cyan; PDB entry 3sj7 ). Locations of the water molecules across the cofactor site in the crystal structure of SDR-WM99c (apo form) are indicated in grey.

Given the high preservation of the active-site tetrad side chains and nucleotide cofactor-binding pocket, we propose the catalytic chemistry for SDR-WM99c to be as is generally observed across the SDR family (Filling et al., 2002[Filling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677-25684.], Kallberg et al., 2002[Kallberg, Y., Oppermann, U., Jörnvall, H. & Persson, B. (2002). Eur. J. Biochem. 269, 4409-4417.]; Oppermann et al., 2003[Oppermann, U., Filling, C., Hult, M., Shafqat, N., Wu, X., Lindh, M., Shafqat, J., Nordling, E., Kallberg, Y., Persson, B. & Jörnvall, H. (2003). Chem. Biol. Interact. 143-144, 247-253.]). Thus, the side-chain groups of Tyr159 and Ser146 are proposed to initially hydrogen bond to the substrate. According to the mechanism proposed by Jornvall and coworkers (Filling et al., 2002[Filling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677-25684.]), the subsequent proton-relay steps would likely follow: NADP, substrate, Ser146, Tyr159, ribose (cofactor) 2′-hydroxyl group, Lys163, water, Asn117 to bulk solvent. Located in our structure adjacent to Asn117 (2.7 Å) is a water molecule that could be utilized at the end of this proposed relay.

Across the SDR family, a cleft resides close to the cofactor-binding region for substrate binding (Filling et al., 2002[Filling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677-25684.]). In SDR-WM99c, such a cleft appears to be located between helices α′ and α′′, i.e. in a markedly flexible region of the apoenzyme structure. As the SDR family utilizes diverse chemistry appropriate to a wide range of substrates (Hoffmann & Maser, 2007[Hoffmann, F. & Maser, E. (2007). Drug Metab. Rev. 39, 87-144.]), it is not possible to define the specific substrate for SDR-WM99c by homology relationships alone.

The SDR-WM99c enzyme, along with the entire genomic island in which it is encoded, recurs in all sequenced members of the A. baumannii IC-II global clonal lineage. Conservation of the island across the IC-II strains suggests that the acquisition of the SDR-WM99c-containing gene cluster by the ancestor of this clonal lineage was a key factor in its success as a globally distributed nosocomial pathogen.

Footnotes

Current address: Australian Synchrotron, 800 Blackburn Road, Clayton, VIC 3168, Australia.

Acknowledgements

We thank Daniel Farrugia (Macquarie University) for insightful communications regarding the GI_12 genomic island. We acknowledge the use of the MX1 beamline at the Australian Synchrotron, Victoria, Australia. This research was supported by the National Health and Medical Research Council. BS acknowledges the receipt of a Macquarie University Research Excellence Scholarship.

References

First citationAdams, P. D. et al. (2010). Acta Cryst. D66, 213–221.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationAfonine, P. V., Grosse-Kunstleve, R. W., Echols, N., Headd, J. J., Moriarty, N. W., Mustyakimov, M., Terwilliger, T. C., Urzhumtsev, A., Zwart, P. H. & Adams, P. D. (2012). Acta Cryst. D68, 352–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationChen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12–21.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationCowtan, K. (2010). Acta Cryst. D66, 470–478.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationDurante-Mangoni, E. & Zarrilli, R. (2011). Future Microbiol. 6, 407–422.  Web of Science PubMed Google Scholar
First citationDutta, D., Bhattacharyya, S. & Das, A. K. (2012). Proteins, 80, 1250–1257.  Web of Science CrossRef CAS PubMed Google Scholar
First citationEijkelkamp, B. A., Stroeher, U. H., Hassan, K. A., Papadimitrious, M. S., Paulsen, I. T. & Brown, M. H. (2011). FEMS Microbiol. Lett. 323, 44–51.  Web of Science CrossRef CAS PubMed Google Scholar
First citationEmsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126–2132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFarrugia, D. N., Elbourne, L. D., Hassan, K. A., Eijkelkamp, B. A., Tetu, S. G., Brown, M. H., Shah, B. S., Peleg, A. Y., Mabbutt, B. C. & Paulsen, I. T. (2013). PLoS One, 8, e58628.  Web of Science CrossRef PubMed Google Scholar
First citationFilling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677–25684.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHoffmann, F. & Maser, E. (2007). Drug Metab. Rev. 39, 87–144.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHolm, L. & Rosenström, P. (2010). Nucleic Acids Res. 38, W545–W549.  Web of Science CrossRef CAS PubMed Google Scholar
First citationIwashkiw, J. A., Seper, A., Weber, B. S., Scott, N. E., Vinogradov, E., Stratilo, C., Reiz, B., Cordwell, S. J., Whittal, R., Schild, S. & Feldman, M. F. (2012). PLoS Pathog. 8, e1002758.  Web of Science CrossRef PubMed Google Scholar
First citationJörnvall, H., Hedlund, J., Bergman, T., Oppermann, U. & Persson, B. (2010). Biochem. Biophys. Res. Commun. 396, 125–130.  Web of Science PubMed Google Scholar
First citationJuhas, M., van der Meer, J. R., Gaillard, M., Harding, R. M., Hood, D. W. & Crook, D. W. (2009). FEMS Microbiol. Rev. 33, 376–393.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKallberg, Y., Oppermann, U., Jörnvall, H. & Persson, B. (2002). Eur. J. Biochem. 269, 4409–4417.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895–3906.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLiou, M.-L., Liu, C.-C., Lu, C.-W., Hsieh, M.-F., Chang, K.-C., Kuo, H.-Y., Lee, C.-C., Chang, C.-T., Yang, C.-Y. & Tang, C. Y. (2012). J. Bacteriol. 194, 6974.  Web of Science CrossRef PubMed Google Scholar
First citationMcCoy, A. J. (2007). Acta Cryst. D63, 32–41.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMcPhillips, T. M., McPhillips, S. E., Chiu, H.-J., Cohen, A. E., Deacon, A. M., Ellis, P. J., Garman, E., Gonzalez, A., Sauter, N. K., Phizackerley, R. P., Soltis, S. M. & Kuhn, P. (2002). J. Synchrotron Rad. 9, 401–406.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationOppermann, U., Filling, C., Hult, M., Shafqat, N., Wu, X., Lindh, M., Shafqat, J., Nordling, E., Kallberg, Y., Persson, B. & Jörnvall, H. (2003). Chem. Biol. Interact. 143–144, 247–253.  Web of Science CrossRef PubMed CAS Google Scholar
First citationPeleg, A. Y., Seifert, H. & Paterson, D. L. (2008). Clin. Microbiol. Rev. 21, 538–582.  Web of Science CrossRef PubMed CAS Google Scholar
First citationPhilippsen, A., Schirmer, T., Stein, M. A., Giffhorn, F. & Stetefeld, J. (2005). Acta Cryst. D61, 374–379.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationRamírez, M. S., Vilacoba, E., Stietz, M. S., Merkier, A. K., Jeric, P., Limansky, A. S., Márquez, C., Bello, H., Catalano, M. & Centrón, D. (2013). Curr. Microbiol. 67, 9–14.  Web of Science PubMed Google Scholar
First citationRossmann, M. G., Moras, D. & Olsen, K. W. (1974). Nature (London), 250, 194–199.  CrossRef CAS PubMed Web of Science Google Scholar
First citationTowner, K. J. (2009). J. Hosp. Infect. 73, 355–363.  Web of Science CrossRef PubMed CAS Google Scholar
First citationValenzuela, J. K., Thomas, L., Partridge, S. R., van der Reijden, T., Dijkshoorn, L. & Iredell, J. (2007). J. Clin. Microbiol. 45, 453–460.  Web of Science CrossRef PubMed CAS Google Scholar
First citationVisca, P., Seifert, H. & Towner, K. J. (2011). IUBMB Life, 63, 1048–1054.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWinn, M. D. et al. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Volume 70| Part 10| October 2014| Pages 1318-1323
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds