research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Crystallographic analysis of the N-terminal domain of Middle East respiratory syndrome coronavirus nucleocapsid protein

CROSSMARK_Color_square_no_text.svg

aDepartment of Life Sciences, National Chung Hsing University, Taichung 402, Taiwan, bInstitute of Genomics and Bioinformatics, National Chung Hsing University, Taichung 402, Taiwan, and cInstitute of Biomedical Sciences, Academia Sinica, Taipei 11529, Taiwan
*Correspondence e-mail: [email protected]

Edited by M. S. Weiss, Helmholtz-Zentrum Berlin für Materialien und Energie, Germany (Received 18 March 2015; accepted 26 May 2015; online 28 July 2015)

The N-terminal domain of the nucleocapsid protein from Middle East respiratory syndrome coronavirus (MERS-CoV NP-NTD) contains many positively charged residues and has been identified to be responsible for RNA binding during ribonucleocapsid formation by the virus. In this study, the crystallization and crystallographic analysis of MERS-CoV NP-NTD (amino acids 39–165), with a molecular weight of 14.7 kDa, are reported. MERS-CoV NP-NTD was crystallized at 293 K using PEG 3350 as a precipitant and a 94.5% complete native data set was collected from a cooled crystal at 77 K to 2.63 Å resolution with an overall Rmerge of 9.6%. The crystals were monoclinic and belonged to space group P21, with unit-cell parameters a = 35.60, b = 109.64, c = 91.99 Å, β = 101.22°. The asymmetric unit contained four MERS-CoV NP-NTD molecules.

1. Introduction

Between 2003 and 2004, Severe acute respiratory syndrome coronavirus (SARS-CoV) caused a worldwide epidemic and had a significant economic impact in countries affected by the outbreak (Lai, 2003[Lai, M. M. C. (2003). J. Biomed. Sci. 10, 664-675.]). In 2004, another alphacoronavirus, Human coronavirus NL63 (HCoV-NL63), was isolated from a seven-month-old child in the Netherlands suffering from bronchiolitis and conjunctivitis (Pyrc et al., 2004[Pyrc, K., Jebbink, M. F., Berkhout, B. & van der Hoek, L. (2004). Virol. J. 1, 7.]). In 2005, Woo and coworkers discovered the novel betacoronavirus Human coronavirus HKU1 in patients with respiratory-tract infections (Woo et al., 2005[Woo, P. C. Y. et al. (2005). J. Infect. Dis. 192, 1898-1907.]). Recently, Middle East respiratory syndrome coronavirus (MERS-CoV) has been found in patients with severe acute respiratory-tract infections in the Middle East (Woo et al., 2014[Woo, P. C. Y., Lau, S. K. P., Wernery, U., Wong, E. Y. M., Tsang, A. K. L., Johnson, B., Yip, C. C. Y., Lau, C. C. Y., Sivakumar, S., Cai, J.-P., Fan, R. Y. Y., Chan, K.-H., Mareena, R. & Yuen, K.-Y. (2014). Emerg. Infect. Dis. 20, 560-572.]). As is the case for all coronaviral infections, there are no efficacious therapies currently available against coronaviral diseases, making the development of anti­coronaviral compounds a priority. The virion envelope surrounding the nucleocapsid contains the following structural proteins: S (spike), M (matrix), E (envelope) and N (nucleocapsid). Some of them have a third glycoprotein, HE (haemagglutinin-esterase), which is present in most alphacoronaviruses. The primary function of the HCoV N protein is to recognize a stretch of RNA that serves as a packaging signal and leads to the formation of the ribonucleoprotein (RNP) complex during assembly (Chang et al., 2014[Chang, C.-K., Hou, M.-H., Chang, C.-F., Hsiao, C.-D. & Huang, T.-H. (2014). Antiviral Res. 103, 39-50.]). The RNP may be important in keeping the RNA in an ordered conformation suitable for replication and transcription of the viral genome (Lai, 2003[Lai, M. M. C. (2003). J. Biomed. Sci. 10, 664-675.]; Nelson et al., 2000[Nelson, G. W., Stohlman, S. A. & Tahara, S. M. (2000). J. Gen. Virol. 81, 181-188.]; Huang et al., 2004[Huang, Q., Yu, L., Petros, A. M., Gunasekera, A., Liu, Z., Xu, N., Hajduk, P., Mack, J., Fesik, S. W. & Olejniczak, E. T. (2004). Biochemistry, 43, 6059-6063.]; Navas-Martín & Weiss, 2004[Navas-Martín, S. R. & Weiss, S. (2004). J. Neurovirol. 10, 75-85.]). In addition, the N protein has been identified as an important diagnostic marker and the most `immunodominant' antigen in infected hosts (Chan et al., 2005[Chan, K. H., Cheng, V. C. C., Woo, P. C. Y., Lau, S. K. M., Poon, L. L. M., Guan, Y., Seto, W. H., Yuen, K. Y. & Peiris, J. S. M. (2005). Clin. Diagn. Lab. Immunol. 12, 1317-1321.]; Woo et al., 2004[Woo, P. C. Y., Lau, S. K. P., Wong, B. H. L., Chan, K.-H., Hui, W.-T., Kwan, G. S. W., Peiris, J. S. M., Couch, R. B. & Yuen, K.-Y. (2004). J. Clin. Microbiol. 42, 5885-5888.]; Liang et al., 2013[Liang, F.-Y., Lin, L.-C., Ying, T.-H., Yao, C.-W., Tang, T.-K., Chen, Y.-W. & Hou, M. H. (2013). J. Virol. Methods, 187, 413-420.]).

The N protein of MERS-CoV, with a molecular weight of 45.6 kDa and a pI of 10.05, is highly basic and hydrophilic (Woo et al., 2014[Woo, P. C. Y., Lau, S. K. P., Wernery, U., Wong, E. Y. M., Tsang, A. K. L., Johnson, B., Yip, C. C. Y., Lau, C. C. Y., Sivakumar, S., Cai, J.-P., Fan, R. Y. Y., Chan, K.-H., Mareena, R. & Yuen, K.-Y. (2014). Emerg. Infect. Dis. 20, 560-572.]). Previous studies revealed that the N-terminal domain of CoV (NP-NTD) contains mostly positively charged residues, which are responsible for RNA binding, while the C-terminal domain (NP-CTD) mainly acts as an oligomerization module to form a capsid (Huang et al., 2009[Huang, C.-Y., Hsu, Y.-L., Chiang, W.-L. & Hou, M.-H. (2009). Protein Sci. 18, 2209-2218.]; Saikatendu et al., 2007[Saikatendu, K. S., Joseph, J. S., Subramanian, V., Neuman, B. W., Buchmeier, M. J., Stevens, R. C. & Kuhn, P. (2007). J. Virol. 81, 3913-3921.]; Lo et al., 2013[Lo, Y.-S., Lin, S.-Y., Wang, S.-M., Wang, C.-T., Chiu, Y.-L., Huang, T.-H. & Hou, M.-H. (2013). FEBS Lett. 587, 120-127.]; Chen et al., 2013[Chen, I.-J., Yuann, J.-M. P., Chang, Y.-M., Lin, S.-Y., Zhao, J., Perlman, S., Shen, Y.-Y., Huang, T.-H. & Hou, M.-H. (2013). Biochim. Biophys. Acta, 1834, 1054-1062.]). The central disordered region of the N protein has also been shown to contain an RNA-binding region (Chang et al., 2009[Chang, C.-K., Hsu, Y.-L., Chang, Y.-H., Chao, F.-A., Wu, M.-C., Huang, Y.-S., Hu, C.-K. & Huang, T.-H. (2009). J. Virol. 83, 2255-2264.]). We have shown that compounds that bind to the NP-NTD and interfere with NP–RNA interactions provide valuable leads for the development of anti-coronaviral therapeutics (Lin et al., 2014[Lin, S.-Y., Liu, C.-L., Chang, Y.-M., Zhao, J., Perlman, S. & Hou, M.-H. (2014). J. Med. Chem. 57, 2247-2257.]). The crystal structures of several NP-NTDs, including those from SARS-CoV, Infectious bronchitis virus (IBV), Human coronavirus OC43 (HCoV-OC43) and Mouse hepatitis virus (MHV), have been described (Chen et al., 2013[Chen, I.-J., Yuann, J.-M. P., Chang, Y.-M., Lin, S.-Y., Zhao, J., Perlman, S., Shen, Y.-Y., Huang, T.-H. & Hou, M.-H. (2013). Biochim. Biophys. Acta, 1834, 1054-1062.]; Ma et al., 2010[Ma, Y., Tong, X., Xu, X., Li, X., Lou, Z. & Rao, Z. (2010). Protein Cell, 1, 688-697.]; Saikatendu et al., 2007[Saikatendu, K. S., Joseph, J. S., Subramanian, V., Neuman, B. W., Buchmeier, M. J., Stevens, R. C. & Kuhn, P. (2007). J. Virol. 81, 3913-3921.]; Jayaram et al., 2006[Jayaram, H., Fan, H., Bowman, B. R., Ooi, A., Jayaram, J., Collisson, E. W., Lescar, J. & Prasad, B. V. (2006). J. Virol. 80, 6612-6620.]; Yu et al., 2006[Yu, I.-M., Oldham, M. L., Zhang, J. & Chen, J. (2006). J. Biol. Chem. 281, 17134-17139.]; Fan et al., 2005[Fan, H., Ooi, A., Tan, Y. W., Wang, S., Fang, S., Liu, D. X. & Lescar, J. (2005). Structure, 13, 1859-1868.]). In order to clarify the mechanism by which the N protein of MERS-CoV bind to nucleic acids, we have undertaken the determination of the crystal structure of the N-terminal domain of MERS-CoV spanning residues 39–165, which shares 58% identity to NP-NTD of SARS-CoV. The results presented in this paper mainly concern the crystallization and preliminary X-ray structural analysis of MERS-CoV NP-NTD.

2. Materials and methods

2.1. Macromolecule production

The templates for the MERS-CoV N protein were purchased from AllBio Science Incorporated, Taichung, Taiwan. Truncated forms of recombinant MERS-CoV NP-NTD were generated by polymerase chain reaction (PCR) of a pGENT plasmid encoding the N-protein gene using different primers. The PCR products were digested with NdeI and XhoI, and the DNA fragments were cloned into pET-28a (Novagen) using T4 ligase (NEB). Expression of the protein was initiated by adding IPTG to a final concentration of 1 mM followed by incubation at 10°C for 24 h. After harvesting the bacteria by centrifugation (8000 rev min−1, 12 min, 4°C), the bacterial pellets were resuspended in lysis buffer (50 mM Tris–HCl, 150 mM NaCl, 15 mM imidazole, 1 mM PMSF pH 7.5) and lysed by sonication on ice using 3 s pulses with 6 s pauses for a total of 10 min. Soluble proteins were obtained from the supernatant after centrifugation (13 000 rev min−1, 40 min, 4°C). NP-NTD carrying an N-terminal His6 tag fused to a SSGLVPRGSHM linker sequence was purified using an Ni–NTA column (Novagen) and eluted with a buffered imidazole gradient of 15–250 mM. Fractions containing pure protein were collected at ∼150 mM imidazole and were dialyzed against 50 mM Tris-buffered solution at pH 7.5 containing 150 mM NaCl for 3 h at 4°C (Fig. 1[link]). The purified NP-NTD was further concentrated using Amicon Ultra centrifugal filter units and centrifuged at 3500g for 10 min at 4°C several times until the concentration of NP-NTD reached 10 mg ml−1 as determined by the Bradford method (BioShop Canada Inc.). Macromolecule-production information is summarized in Table 1[link].

Table 1
Macromolecule-production information

Source organism Middle East respiratory syndrome coronavirus
DNA source The templates for the MERS-CoV N protein were provided by AllBio Science Incorporation, Taichung, Taiwan. The primers for the MERS-CoV N protein were provided by Genomics BioSci & Tech Ltd, New Taipei City, Taiwan.
Forward primer CTTATCGCATATGAACACCGTGAGCTGGTATACCGGC
Reverse primer CTTACGGCTCGAGGGTGCCTTCAATATGAAAGTTTTTCG
Cloning vector pET-28a (Novagen)
Expression vector pET-28a (Novagen)
Expression host Escherichia coli BL21 (DE3) pLysS
Complete amino-acid sequence of the construct produced HHHHHHSSGLVPRGSHMNTVSWYTGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYYTGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNFHIEGT
[Figure 1]
Figure 1
SDS–PAGE analysis of MERS-CoV NP-NTD stained with Coomassie Brilliant Blue. Lane M, protein molecular-mass marker (labelled in kDa); lane 1, concentrated MERS-CoV NP-NTD after dialysis; lane 2, purified MERS-CoV NP-NTD.

2.2. Crystallization

Initial crystallization conditions were identified by using the sitting-drop vapour-diffusion method with crystal screening kits from Molecular Dimensions as described previously (Till et al., 2013[Till, M., Robson, A., Byrne, M. J., Nair, A. V., Kolek, S. A., Shaw Stewart, P. D. & Race, P. R. (2013). J. Vis. Exp. (78), e50548.]; Chen et al., 2014[Chen, Y.-W., Jhan, C.-R., Neidle, S. & Hou, M.-H. (2014). Angew. Chem. Int. Ed. 53, 10682-10686.]). Each of the solutions (2 µl) from the crystal screening kits was mixed with 2 µl purified protein solution (10 mg ml−1) and allowed to equilibrate against 300 µl solution in the well at room temperature (∼25°C). The conditions were refined and crystals were grown from a well solution using the sitting-drop vapour-diffusion method by equilibrating a mixture of 2 µl protein solution (10 mg ml−1) and 2 µl reservoir solution against 300 µl reservoir solution consisting of 2 mM NaBr, 75 mM ammonium sulfate, 29% PEG 3350 (Sigma). Crystals appeared within two weeks and the largest crystal in the needle clusters grew to dimensions of approximately 300 × 20 × 10 µm (Fig. 2[link]). Crystallization information is summarized in Table 2[link].

Table 2
Crystallization

Method Vapour diffusion
Plate type 24-well sitting-drop plate (Hampton Research)
Temperature (K) 293
Protein concentration (mg ml−1) 10
Buffer composition of protein solution 50 mM Tris–HCl pH 7.5, 75 mM NaCl
Composition of reservoir solution 2 mM NaBr, 75 mM ammonium sulfate, 29% PEG 3350
Volume and ratio of drop 1:1; 2 µl reservoir solution was mixed with 2 µl purified protein solution
Volume of reservoir (µl) 300
[Figure 2]
Figure 2
Crystals of MERS-CoV NP-NTD obtained by the sitting-drop vapour-diffusion method. The largest crystals in the needle clusters are approximately 300 × 20 × 10 µm in size.

2.3. Data collection and processing

X-ray data were collected using synchrotron radiation with a crystal-to-detector distance of 350 mm. The oscillation width and exposure time for each frame were 1° and 20 s, respectively. Crystallographic data integration and reduction were performed with the HKL-2000 program package (Otwinowski & Minor, 1997[Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307-326.]). The crystallographic data-collection statistics for NP-NTD are listed in Table 3[link].

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source BL13B1 beamline, National Synchrotron Radiation Research Center (NSRRC), Hsinchu, Taiwan
Wavelength (Å) 1.000
Temperature (K) 77
Detector ADSC Q315r
Crystal-to-detector distance (mm) 350
Rotation range per image (°) 1
Total rotation range (°) 360
Exposure time per image (s) 20
Space group P21
a, b, c (Å) 35.60, 109.64, 91.99
α, β, γ (°) 90, 101.22, 90
Mosaicity (°) 1.053
Resolution range (Å) 30–2.63 (2.73–2.63)
Total No. of reflections 138439
No. of unique reflections 13974
Completeness (%) 94.5 (91.4)
Multiplicity 7.1 (5.9)
〈I/σ(I)〉 18.89 (3.03)
Rr.i.m. 0.01 (0.08)
Overall B factor from Wilson plot (Å2) 43.1

3. Results and discussion

The MERS-CoV NP-NTD crystal chosen for this study diffracted to 2.63 Å resolution (Fig. 3[link]) and belonged to space group P21, with unit-cell parameters a = 35.60, b = 109.64, c = 91.99 Å, β = 101.22°. The Matthews coefficient of 2.63 Å3 Da−1 calculated using MATTHEWS_COEF from CCP4 (Winn et al., 2011[Winn, M. D. et al. (2011). Acta Cryst. D67, 235-242.]; Matthews, 1968[Matthews, B. W. (1968). J. Mol. Biol. 33, 491-497.]) suggested that there were four molecules in an asymmetric unit with a solvent content of 59.2%. A homology search for the MERS-CoV NP-NTD structure was performed using the BLAST server (https://blast.ncbi.nlm.nih.gov/Blast.cgi). The model-selection criterion was based on the E-value and the estimated precision value. The sequence-alignment search indicated that MERS-CoV NP-NTD shares high identity with other NP-NTDs from coronaviruses (Supplementary Fig. S1). For example, the MERS-CoV NP-NTD (residues 39–165) has 58% sequence identity to SARS-CoV NP-NTD. The NTD from SARS-CoV (PDB entry 2ofz; Saikatendu et al., 2007[Saikatendu, K. S., Joseph, J. S., Subramanian, V., Neuman, B. W., Buchmeier, M. J., Stevens, R. C. & Kuhn, P. (2007). J. Virol. 81, 3913-3921.]) was chosen as the initial model as its E-value was 1 × 10−23, and a total of 116 residues were modelled. The first molecular-replacement trial was performed using the PERON automated interface at the Protein Tectonics Platform (PTP), RIKEN SPring-8 Center, Japan (Sugahara et al., 2008[Sugahara, M. et al. (2008). J. Struct. Funct. Genomics, 9, 21-28.]). The core of the model consisted of a tightly packed β-sheet surrounded by large loops. The molecular-replacement method was then applied to the model using MOLREP (Vagin & Teplyakov, 2010[Vagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22-25.]) using reflections in the resolution range 8.5–3.0 Å. Single and unambiguous solutions for four NP-NTD molecules in one asymmetric unit were obtained in the rotation and translation functions, yielding a final correlation coefficient of 0.81 and an R factor of 0.32. Structural refinement of MERS-CoV NP-NTD is currently in progress.

[Figure 3]
Figure 3
Typical X-ray diffraction pattern of MERS-CoV NP-NTD.

Supporting information


Acknowledgements

This work was supported by the MOST 103-2113-M-005-007-MY3. We thank the beamline staff at the BL13B1 beamline, National Synchrotron Radiation Research Center (NSRRC), Hsinchu, Taiwan for assistance. We are also grateful for access to the Protein Tectonics Platform (PTP), which is a structural biology facility collaboration between RIKEN SPring-8 Center, Japan and NSRRC, Taiwan.

References

First citationChan, K. H., Cheng, V. C. C., Woo, P. C. Y., Lau, S. K. M., Poon, L. L. M., Guan, Y., Seto, W. H., Yuen, K. Y. & Peiris, J. S. M. (2005). Clin. Diagn. Lab. Immunol. 12, 1317–1321.  PubMed CAS Google Scholar
First citationChang, C.-K., Hou, M.-H., Chang, C.-F., Hsiao, C.-D. & Huang, T.-H. (2014). Antiviral Res. 103, 39–50.  Web of Science CrossRef CAS PubMed Google Scholar
First citationChang, C.-K., Hsu, Y.-L., Chang, Y.-H., Chao, F.-A., Wu, M.-C., Huang, Y.-S., Hu, C.-K. & Huang, T.-H. (2009). J. Virol. 83, 2255–2264.  Web of Science CrossRef PubMed CAS Google Scholar
First citationChen, I.-J., Yuann, J.-M. P., Chang, Y.-M., Lin, S.-Y., Zhao, J., Perlman, S., Shen, Y.-Y., Huang, T.-H. & Hou, M.-H. (2013). Biochim. Biophys. Acta, 1834, 1054–1062.  Web of Science CrossRef CAS PubMed Google Scholar
First citationChen, Y.-W., Jhan, C.-R., Neidle, S. & Hou, M.-H. (2014). Angew. Chem. Int. Ed. 53, 10682–10686.  Web of Science CrossRef CAS Google Scholar
First citationFan, H., Ooi, A., Tan, Y. W., Wang, S., Fang, S., Liu, D. X. & Lescar, J. (2005). Structure, 13, 1859–1868.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHuang, C.-Y., Hsu, Y.-L., Chiang, W.-L. & Hou, M.-H. (2009). Protein Sci. 18, 2209–2218.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHuang, Q., Yu, L., Petros, A. M., Gunasekera, A., Liu, Z., Xu, N., Hajduk, P., Mack, J., Fesik, S. W. & Olejniczak, E. T. (2004). Biochemistry, 43, 6059–6063.  Web of Science CrossRef PubMed CAS Google Scholar
First citationJayaram, H., Fan, H., Bowman, B. R., Ooi, A., Jayaram, J., Collisson, E. W., Lescar, J. & Prasad, B. V. (2006). J. Virol. 80, 6612–6620.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLai, M. M. C. (2003). J. Biomed. Sci. 10, 664–675.  CrossRef PubMed CAS Google Scholar
First citationLiang, F.-Y., Lin, L.-C., Ying, T.-H., Yao, C.-W., Tang, T.-K., Chen, Y.-W. & Hou, M. H. (2013). J. Virol. Methods, 187, 413–420.  CrossRef CAS PubMed Google Scholar
First citationLin, S.-Y., Liu, C.-L., Chang, Y.-M., Zhao, J., Perlman, S. & Hou, M.-H. (2014). J. Med. Chem. 57, 2247–2257.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLo, Y.-S., Lin, S.-Y., Wang, S.-M., Wang, C.-T., Chiu, Y.-L., Huang, T.-H. & Hou, M.-H. (2013). FEBS Lett. 587, 120–127.  CrossRef CAS PubMed Google Scholar
First citationMa, Y., Tong, X., Xu, X., Li, X., Lou, Z. & Rao, Z. (2010). Protein Cell, 1, 688–697.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMatthews, B. W. (1968). J. Mol. Biol. 33, 491–497.  CrossRef CAS PubMed Web of Science Google Scholar
First citationNavas-Martín, S. R. & Weiss, S. (2004). J. Neurovirol. 10, 75–85.  PubMed Google Scholar
First citationNelson, G. W., Stohlman, S. A. & Tahara, S. M. (2000). J. Gen. Virol. 81, 181–188.  Web of Science CrossRef PubMed CAS Google Scholar
First citationOtwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326.  CrossRef CAS PubMed Web of Science Google Scholar
First citationPyrc, K., Jebbink, M. F., Berkhout, B. & van der Hoek, L. (2004). Virol. J. 1, 7.  Web of Science CrossRef PubMed Google Scholar
First citationSaikatendu, K. S., Joseph, J. S., Subramanian, V., Neuman, B. W., Buchmeier, M. J., Stevens, R. C. & Kuhn, P. (2007). J. Virol. 81, 3913–3921.  Web of Science CrossRef PubMed CAS Google Scholar
First citationSugahara, M. et al. (2008). J. Struct. Funct. Genomics, 9, 21–28.  CrossRef PubMed CAS Google Scholar
First citationTill, M., Robson, A., Byrne, M. J., Nair, A. V., Kolek, S. A., Shaw Stewart, P. D. & Race, P. R. (2013). J. Vis. Exp. (78), e50548.  Google Scholar
First citationVagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22–25.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationWinn, M. D. et al. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationWoo, P. C. Y. et al. (2005). J. Infect. Dis. 192, 1898–1907.  CrossRef PubMed CAS Google Scholar
First citationWoo, P. C. Y., Lau, S. K. P., Wernery, U., Wong, E. Y. M., Tsang, A. K. L., Johnson, B., Yip, C. C. Y., Lau, C. C. Y., Sivakumar, S., Cai, J.-P., Fan, R. Y. Y., Chan, K.-H., Mareena, R. & Yuen, K.-Y. (2014). Emerg. Infect. Dis. 20, 560–572.  CrossRef CAS PubMed Google Scholar
First citationWoo, P. C. Y., Lau, S. K. P., Wong, B. H. L., Chan, K.-H., Hui, W.-T., Kwan, G. S. W., Peiris, J. S. M., Couch, R. B. & Yuen, K.-Y. (2004). J. Clin. Microbiol. 42, 5885–5888.  CrossRef PubMed CAS Google Scholar
First citationYu, I.-M., Oldham, M. L., Zhang, J. & Chen, J. (2006). J. Biol. Chem. 281, 17134–17139.  Web of Science CrossRef PubMed CAS Google Scholar

© International Union of Crystallography. Prior permission is not required to reproduce short quotations, tables and figures from this article, provided the original authors and source are cited. For more information, click here.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds