research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Structure of GTP cyclo­hydrolase I from Listeria monocytogenes, a potential anti-infective drug target

crossmark logo

aHamburg School of Food Science, Universität Hamburg, Grindelallee 117, 20146 Hamburg, Germany, bInstitute for Biochemistry and Molecular Biology, Laboratory for Structural Biology of Infection and Inflammation, Universität Hamburg, Notkestrasse 85, 22607 Hamburg, Germany, cThe Hamburg Center for Ultrafast Imaging, Universität Hamburg, Luruper Chaussee 149, 22761 Hamburg, Germany, dDepartment of Chemistry, Technical University of Munich, Lichtenbergstrasse 4, 85748 Garching, Germany, and eHamburg Outstation, European Molecular Biology Laboratory Hamburg, Notkestrasse 85, 22607 Hamburg, Germany
*Correspondence e-mail: [email protected], [email protected]

Edited by N. Sträter, University of Leipzig, Germany (Received 15 March 2019; accepted 4 August 2019; online 30 August 2019)

A putative open reading frame encoding GTP cyclohydrolase I from Listeria monocytogenes was expressed in a recombinant Escherichia coli strain. The recombinant protein was purified and was confirmed to convert GTP to dihydroneopterin triphosphate (Km = 53 µM; vmax = 180 nmol mg−1 min−1). The protein was crystallized from 1.3 M sodium citrate pH 7.3 and the crystal structure was solved at a resolution of 2.4 Å (Rfree = 0.226) by molecular replacement using human GTP cyclohydrolase I as a template. The protein is a D5-symmetric decamer with ten topologically equivalent active sites. Screening a small library of about 9000 compounds afforded several inhibitors with IC50 values in the low-micromolar range. Several inhibitors had significant selectivity with regard to human GTP cyclohydrolase I. Hence, GTP cyclohydrolase I may be a potential target for novel drugs directed at microbial infections, including listeriosis, a rare disease with high mortality.

1. Introduction

GTP cyclohydrolase I (EC 3.5.4.16) catalyzes a mechanistically complex ring expansion whereby GTP is converted to dihydroneopterin triphosphate (CAS Registry No. 20574-65-6; Supplementary Fig. S1; Yim & Brown, 1976View full citation; Burg & Brown, 1968View full citation; Fukushima et al., 1977View full citation; for a review, see Gräwert et al., 2013View full citation). More specifically, the imidazole ring of the substrate is hydrolytically opened with the assistance of an essential zinc ion (Bracher et al., 2001View full citation), and the resulting pyrimidine intermediate undergoes an Amadori rearrangement of the carbohydrate side chain followed by ring closure (Bracher et al., 1998View full citation; Rebelo et al., 2003View full citation; Tanaka et al., 2005View full citation). The enzyme product, dihydroneopterin triphosphate, serves as the first committed intermediate in the biosynthesis of tetrahydro­folate by many microorganisms and as the first committed intermediate in the biosynthesis of tetrahydro­biopterin by animals (Gräwert et al., 2013View full citation).

Inhibitors of tetrahydrofolate biosynthesis have played important roles in the treatment of a wide variety of microbial and protozoan infections (Fig. 1[link]; Brown, 1962View full citation; for a review, see Swarbrick et al., 2008View full citation). Specifically, sulfonamide drugs inhibiting dihydropteroate synthase, the penultimate enzyme of the dihydrofolate pathway, came to the market in the 1930s as the first synthetic agents with broad antimicrobial activity (Nobel Prize awarded to Gerhard Domagk in 1939; Nobel Media AB, 2014aView full citation). Whereas sulfonamides have been superseded by more recently developed drugs in the treatment of bacterial infections, they continue to be relevant for certain protozoan diseases such as toxoplasmosis and drug-resistant malaria.

[Figure 1]
Figure 1
Bacterial tetrahydrofolate biosynthesis. Enzymes that are existing targets or are potential new targets are shown in black dotted rectangles. Antibiotics inhibiting the enzymes of this pathway are shown near their targets.

The subsequent development of pyrimethamin (in 1950) and trimethoprim (in 1956), which are inhibitors of dihydro­folate reductase, was also honored with Nobel Prizes to Gertrude Elion and George Hitchings in 1988 (Nobel Media AB, 2014View full citationb); these authors also pioneered the combination of two antifolates directed at two different targets for improved antimicrobial activity.

During the ensuing heyday of the emerging antibiotics era, the emphasis in the field shifted away from synthetic compounds in the direction of natural and semisynthetic agents, while the elucidation of the tetrahydrofolate pathway in the second half of the 20th century has so far not been conducive to the discovery of novel antifolate drugs (for a review, see Burg & Brown, 1968View full citation).

This paper describes the structure elucidation of GTP cyclohydrolase I from Listeria monocytogenes, the foodborne causative agent of listeriosis, which has a mortality rate in the region of 50% (Lorber, 1997View full citation; Schlech & Acheson, 2000View full citation; Granier et al., 2011View full citation). At present, listeriosis infections are usually treated with ampicillin. Cephalosporins are ineffective in Listeria and thus no substitute is available in the case of sensitivity towards β-lactam antibiotics or in the case of emerging resistance. A potential role of the enzyme as an anti-infective drug target is suggested by the discovery of inhibitors which might serve as lead structures, probably also against other pathogens.

2. Materials and methods

2.1. Macromolecule production

2.1.1. Gene cloning and bacterial culture

The putative folE gene from L. monocytogenes (ATCC BAA-679, LGC Standards GmbH, Wesel, Germany) was amplified by two consecutive PCR cycles using the primer pair Fw-LmGTPCHI and Bw-BamHI-LmGTPCHI and the primer pair Fw-EcoRI-LmGTPCHI and Bw-BamHI-LmGTPCHI. The amplificate was digested with EcoRI and BamHI and was ligated into the plasmid pNCO113 that had been treated with the same restriction enzymes. The resulting plasmid pNCO-His6-EK-LmGTP-CHI was transformed into chemically competent XL1-Blue cells (Bullock et al., 1987View full citation; Stratagene, Amsterdam, The Netherlands), affording strain XL1 pNCO-His6-EK-LmGTPCHI. Strain XL1 pNCO-His6-EK-LmGTP-CHI was grown in Terrific Broth containing 170 mg ampicillin per litre for 4 h at 37°C and for a further 36 h at 30°C. The cells were harvested by centrifugation at 4°C and 4000 rev min−1 for 30 min, washed with saline [0.9%(w/v) NaCl] and stored at −20°C.

2.1.2. Protein purification

All steps were carried out at 4°C unless stated otherwise. The cells were thawed on ice, resuspended in buffer A (50 mM Tris–HCl pH 8.0 containing 250 mM NaCl) and disrupted by sonication. The mixture was centrifuged and the supernatant was loaded onto a nickel–NTA agarose column (30 ml; Macherey-Nagel, Düren, Germany) that had been equilibrated with buffer A. The column was washed with 300 ml buffer A followed by 100 and 500 mM imidazole in buffer A. Fractions were combined and concentrated by ultrafiltration. The solution was applied onto a Superdex 200 prep-grade column (5.3 cm2 × 60 cm), which was developed with buffer A. Fractions were combined and concentrated by ultrafiltration. Dithiothreitol was added to a final concentration of 2 mM and the protein was stored at −80°C. Human GTP cyclohydrolase I protein was prepared as reported previously (Auerbach et al., 2000View full citation). Macromolecule-production information is summarized in Table 1[link].

Table 1
Macromolecule-production information

Restriction sites are underlined. The first triplet of the folE gene and the stop codon are shown in bold. The His6 tag, His6 tag-coding sequences and enteropeptidase- and enteropeptidase-coding sequences are shown in italics.

Source organism L. monocytogenes
Forward primer CACCATCATGGTTCCGATGATGACGATAAGGAGCAAATAGACAAACAAAAGATTGCTGATGCG
Forward primer II ATAATAATAGAATTCATTAAAGAGGAGAAATTAACCATGCATCATCACCACCATCATGGTTCCGATGATGACGATAAG
Reverse primer TATTATTATGGATCCTTAATTATGCTTAATTAAAGCCAAAACTTCACTTCTAAGCTT
Cloning vector pNCO113
Expression vector pNCO113
Expression host E. coli
Complete amino-acid sequence of the construct produced MHHHHHHGSDDDDKEQIDKQKIADAVKVILEAVGENPDREGLIDTPMRVARMYEEVFAGLKKDPSVHFDTIFEEQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLARVVDDVSRRPQLQERITTTVAEIMMEKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALIKHN

2.2. Crystallization

Crystals were grown by the sitting-drop vapor-diffusion method at 20°C. In initial screening, the Index, Crystal Screen and Crystal Screen 2 kits (Hampton Research, Aliso Viejo, California, USA) were used with a final protein concentration of 5 mg ml−1. The protein was supplied in 10 mM Tris–HCl pH 7.0 containing 75 mM NaCl. Aliquots (1 µl) of protein solution were mixed with 1 µl reservoir buffer solution to obtain a sitting drop. The mother-liquor reservoir contained 60 µl reservoir buffer solution. The protein crystallized from 1.33 M sodium citrate pH 7.3 containing 0.1 M HEPES. Ortho­rhombic crystals (space group P21, unit-cell parameters a = 78, b = 142, c = 91 Å, 47% solvent content) grew to final dimensions of about 400 × 500 × 300 µm. Crystallization information is summarized in Table 2[link].

Table 2
Crystallization

Method Sitting drop
Plate type 96-well
Temperature (K) 283
Protein concentration (mg ml−1) 5
Buffer composition of protein solution 10 mM Tris–HCl pH 7.0, 75 mM NaCl
Composition of reservoir solution 0.1 M HEPES pH 7.3, 1.33 M sodium citrate
Volume and ratio of drop 2 µl (1:1)
Volume of reservoir (µl) 60

2.3. Data collection and processing

Prior to data collection, crystals were soaked in glycerol for 10 min and were subsequently shock-frozen in a nitrogen stream at 100 K (Oxford Cryosystems). A native data set was collected on the P14 beamline at DESY, Hamburg, Germany. The XDS program package (Kabsch, 2010View full citation) was used to process the collected data. The crystals diffracted to a resolution of 2.4 Å. Data-collection and processing statistics are summarized in Table 3[link].

Table 3
Data collection and processing

Diffraction source Beamline P14 (MX2), PETRA III, EMBL c/o DESY
Wavelength (Å) 1.23953
Temperature (K) 100
Detector Dectris PILATUS 6M
Crystal-to-detector distance (mm) 349.213
Rotation range per image (°) 0.1
Total rotation range (°) 360
Exposure time per image (s) 0.1
Space group P21
a, b, c (Å) 78.25, 141.85, 90.78
α, β, γ (°) 90, 104.61, 90
Mosaicity (°) 0.251
Resolution range (Å) 30.00–2.40 (2.53–2.40)
Total No. of reflections 510889
No. of unique reflections 74531
Completeness (%) 99.7 (99.8)
Multiplicity 6.9 (6.8)
I/σ(I)〉 19.2 (3.5)
Rr.i.m. 0.076 (0.617)
Overall B factor from Wilson plot (Å2) 39.9
†Estimated Rr.i.m. = Rmerge[N/(N − 1)]1/2, where N is the data multiplicity.

2.4. Structure solution and refinement

Crystal structure analysis was performed by molecular replacement with Phaser (McCoy et al., 2007View full citation) within the CCP4 package (Winn et al., 2011View full citation) using the atomic coordinates of human GTP cyclohydrolase I (PDB entry 1fb1; Auerbach et al., 2000View full citation) as a template. TLS refinement including non­crystallographic symmetry averaging was performed with the PDB-REDO server (Joosten et al., 2014View full citation). The electron density and model were improved by successive rounds of model building and subsequent refinement using Coot (Emsley et al., 2010View full citation) and REFMAC5 (Murshudov et al., 2011View full citation). The asymmetric unit contains one decamer of GTP cyclohydrolase I. 15 N-terminal residues (MHHHHHHGSDDDDKE) and one C-terminal residue (N) are disordered and thus are missing from the model in every monomer. MolProbity (Chen et al., 2010View full citation) was used for Ramachandran analysis. The atomic coordinates and structure factors of GTP cyclohydrolase I from L. monocytogenes have been deposited in the PDB as entry 4uqf. Refinement statistics are summarized in Table 4[link].

Table 4
Structure refinement

Resolution range (Å) 87.84–2.40 (2.462–2.400)
Completeness (%) 99.6
No. of reflections, working set 70754 (5214)
No. of reflections, test set 3752 (281)
Final Rcryst 0.193 (0.309)
Final Rfree 0.226 (0.314)
Cruickshank DPI 0.25
No. of non-H atoms
 Protein 14475
 Water 0
 Total 14475
R.m.s. deviations
 Bonds (Å) 0.014
 Angles (°) 1.773
Average B factors (Å2)
 Protein 49.6
Ramachandran plot
 Favored regions (%) 97.7
 Additionally allowed (%) 2.1
 Outliers (%) 0.2

3. Results and discussion

3.1. Results

A putative folE gene encoding GTP cyclohydrolase I was amplified from L. monocytogenes DNA by PCR (Mullis et al., 1986View full citation) and was cloned into the pNCO113 plasmid (Stüber et al., 1990View full citation), where it was preceded by sequence elements encoding a polyhistidine tag and an enterokinase cleavage site. After transformation into a recombinant Escherichia coli host strain, the plasmid directed the synthesis of a polypeptide with an approximate mass of 22 kDa, as estimated by SDS–PAGE (Laemmli, 1970View full citation), which was in good agreement with the calculated mass of 22.9 kDa. The recombinant protein was isolated by metal-affinity chromatography. The predicted sequence was confirmed by partial Edman degradation (Edman, 1960View full citation) and by mass spectrometry of a tryptic digest (Mann & Wilm, 1994View full citation).

The recombinant protein catalyzes the conversion of GTP to dihydroneopterin triphosphate (vmax = 180 nmol mg−1 min−1, Km = 53 µM; Supplementary Fig. S3) as determined by photometric analysis (for details of the enzyme assay, see the supporting information). The formation of the second enzyme product, formate, was also directly detected by NMR spectroscopy using [U-13C10]GTP as substrate. In line with reports on other known GTP cyclohydrolase I orthologs, the addition of divalent cations to the assay mixtures was not required for activity.

Equilibrium sedimentation yielded a molecular weight of 212 ± 30 kDa. Boundary sedimentation resulted in a sedimentation velocity of 9.6 S. Mass spectrometry revealed the presence of 0.9 moles of zinc per mole of polypeptide.

The protein is a D5-symmetric decamer with close similarity to several orthologous proteins from eubacteria and animals (Fig. 2[link], Supplementary Table S1; Nar et al., 1995View full citation). The r.m.s.d. values to previously reported GTP cyclohydrolase I structures were in the range 0.76–1.3 Å for the monomers, whereas r.m.s.d. values in the range 0.12–0.34 Å were found on comparing individual L. monocytogenes GTP cyclohydrolase I monomers. However, no appreciable density representing the essential zinc ions was present, and the two canonical cysteine residues Cys78 and Cys150 that form part of the putative zinc-binding site (for a sequence alignment, see Supplementary Fig. S2) were oxidized to the disulfide level; it is most probable that the zinc had been lost owing to the chelating activity of the citrate that was used as a precipitant, and loss of the metal cation had been followed by oxidation of the zinc-chelating cysteine residues. A similar observation had previously been made for crystals of GTP cyclohydrolase I from E. coli that had been exposed to EDTA. In comparison, the Listeria protein appears to be even more sensitive to chelator-induced zinc-ion loss, but a search for other (nonchelating) crystallization conditions has been unsuccessful to date.

[Figure 2]
Figure 2
Structural features of L. monocytogenes GTP cyclohydrolase I. (a) Close-up of the active site. Conserved amino acids are shown in stick representation. (b) Active-site composition; the view is along one C2 axis. Monomer 1 (blue) and monomer 2 (orange) belong to the `top' pentamer; monomer 3 (green) belongs to the `bottom' pentamer. Intense coloring indicates the active site (one of ten) formed by these monomers. (c) View along the C5 axis. Monomers of the `top' pentamer are shown in distinct colors and the `bottom' pentamer is in black and white. (d) Monomer architecture. H, helix; S, strand. These figures were prepared using PyMOL (DeLano, 2004View full citation). Corresponding color coding is used in (a) and (b); arbitrary color coding is used in (c) and (d).

In parallel to the findings for other decameric GTP cyclohydrolases (Auerbach et al., 2000View full citation; Nar et al., 1995View full citation; Tanaka et al., 2005View full citation; Maita et al., 2002View full citation), each of the ten active sites of the protein is located at the interface of three subunits (two in one C5-symmetric unit and a third in the adjacent C5-symmetric pentamer unit). The residues lining the active-site cavity of the L. monocytogenes protein have high temperature factors, possibly owing to the absence of a divalent cation.

In order to explore the druggability of the protein, we screened a small library of about 9000 highly diverse compounds (Bracher et al., 1998View full citation). Assays were run in 384-well plates and were monitored photometrically at 330 nm. Hits were rescreened against GTP cyclohydrolase I from L. monocytogenes and human GTP cyclohydrolase I, and IC50 values were determined using the photometric assay. Semilogarithmic dose–response curves showed symmetrical, S-shaped features, and the overall Z factor (Zhang et al., 1999View full citation) of the screen was 0.87. Three heterocyclic compounds inhibited the L. monocytogenes enzyme with IC50 values in the low double-digit micromolar range while not acting as strong inhibitors of human GTP cyclohydrolase I (Fig. 3[link]; for details of the high-throughput assay, see the supporting information). Although stronger inhibitors have been reported down to a Ki of 5.4 nM (Tanaka et al., 2005View full citation), all of the inhibitors reported so far are substrate or product analogs.

[Figure 3]
Figure 3
Dose–response curves. Red, GTP cyclohydrolase I from L. monocytogenes; blue, human GTP cyclohydrolase I. Inhibition of the Listeria enzyme is significantly stronger compared with the human enzyme. IC50 values were calculated with DynaFit (BioKin, Watertown, Massachusetts, USA; Kuzmič, 1996View full citation).

3.2. Discussion

Animals and many microorganisms feature homodeca­meric, D5-symmetric GTP cyclohydrolases I with molecular masses of about 200 kDa. The enzyme from L. monocytogenes is similar in terms of sequence and three-dimensional structure to orthologs from eubacteria (E. coli and Yersinia pestis). The structure is also similar to mammalian cyclohydrolase I (rat and mouse), although the mammalian protomers are somewhat longer.

Our data confirm that GTP cyclohydrolase I from L. monocytogenes is well suited for high-throughput screening. Importantly, screening does not require any supplementary enzymes, since the enzyme product can be monitored directly by photometry.

Screening a small library of about 9000 structurally diverse compounds retrieved an inhibitor with an IC50 of 13 µM; importantly, the compound was much less active against human GTP cyclohydrolase I (IC50 > 500 µM).

In order to discuss the potential role of bacterial GTP cyclohydrolase I as an anti-infective drug target, the role of GTP cyclohydrolase I in bacterial pathogens as well as in the human host must be addressed in some detail. Importantly, in 2006 it was found that certain eubacteria do not carry a folE gene but produce a homotetrameric protein designated GTP cyclohydrolase IB that is under the control of the folE2 gene (El Yacoubi et al., 2006View full citation). In contrast to the decameric GTP cyclohydrolases, the type IB protein is not strictly dependent on zinc ions but can use several different divalent transition-metal ions, including iron, for catalysis. In a remarkable parallel to the decameric type I enzymes, the active sites of the type IB enzymes are also located at the interfaces of three adjacent subunits. Moreover, the protein segments that are located at the surface of the active-site cavity align almost perfectly with the cognate sequence elements of GTP cyclohydrolase I, although they have been reshuffled with respect to their location in the overall protein sequence. The folE2-type GTP cyclohydrolase provides a metabolic advantage under conditions of limited zinc supply.

The L. monocytogenes genome does not contain a folE2 gene. However, certain other pathogenic eubacteria contain folE2 genes, either alone or in combination with folE and folE1 genes; multiple genomic copies of folE and folE1 have also been observed. Whether it would be possible to develop inhibitors that act against the type IB as well as the type I GTP cyclohydrolase is as yet unknown. Inhibitors that act only against one type of GTP cyclohydrolase would be significantly restricted with regard to their therapeutic spectrum.

Yet another caveat needs to be considered with regard to the use of GTP cyclohydrolases (type I and/or type IB) as anti-infective drug targets, namely the structural similarity of bacterial GTP cyclohydrolase I to human GTP cyclohydrolase I. The human enzyme catalyzes the first committed step in the biosynthesis of tetrahydrobiopterin that is required for the catabolism of phenylalanine and for the biosynthesis of nitric oxide (for reviews, see Fischer & Bacher, 2005View full citation; Gräwert et al., 2013View full citation). Ideally, any putative drugs directed at microbial GTP cyclohydrolases should be exempt from inhibition of the human ortholog. Nevertheless, the stringency of this argument may not be absolute. In fact, the human enzyme is considered to be a potential target for pain relief (Tegeder et al., 2006View full citation). Although a genetic deficiency of GTP cyclohydrolase causes severe neurological deficits during fetal and childhood development, its inhibition for the duration of treatment of an acute infectious disease in adults for short periods may be acceptable.

Historically, the success of antifolates as anti-infective drugs has benefited massively from the possibility of the simultaneous inhibition of two folate-pathway enzymes, namely dihydro­pteroate synthase and dihydrofolate reductase (Fig. 1[link]). Despite the caveats addressed above, the possibility of adding a third potential anchor point to the arsenal of antifolate strategies may be worth considering. In this context, it is also relevant to note that fungal protozoan pathogens only have the classical GTP cyclohydrolase I, in contrast to the more complex situation in bacterial pathogens.

Supporting information


Acknowledgements

The compound library was kindly provided by BASF SE, Ludwigshafen, Germany. We thank Ruslan Sanishvili, Argonne National Laboratory for organizing the CCP4 summer school in 2010.

Funding information

Funding for this research was provided by: Deutsche Forschungsgemeinschaft; Hans-Fischer-Gesellschaft. Markus Perbandt was supported by DFG-EXC1074/Deutsche Forschungsgemeinschaft (German Research Foundation)/International.

References

Return to citationAuerbach, G., Herrmann, A., Bracher, A., Bader, G., Gütlich, M., Fischer, M., Neukamm, M., Garrido-Franco, M., Richardson, J., Nar, H., Huber, R. & Bacher, A. (2000). Proc. Natl Acad. Sci. USA, 97, 13567–13572.  CrossRef PubMed CAS Google Scholar
Return to citationBracher, A., Eisenreich, W., Schramek, N., Ritz, H., Götze, E., Herrmann, A., Gütlich, M. & Bacher, A. (1998). J. Biol. Chem. 273, 28132–28141.  CrossRef CAS PubMed Google Scholar
Return to citationBracher, A., Schramek, N. & Bacher, A. (2001). Biochemistry, 40, 7896–7902.  CrossRef PubMed CAS Google Scholar
Return to citationBrown, G. M. (1962). J. Biol. Chem. 237, 536–540.  PubMed CAS Google Scholar
Return to citationBullock, W. O., Fernandez, J. M. & Short, J. M. (1987). Biotechniques, 5, 376–377.  CAS Google Scholar
Return to citationBurg, A. W. & Brown, G. M. (1968). J. Biol. Chem. 243, 2349–2358.  CAS PubMed Google Scholar
Return to citationChen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12–21.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationDeLano, W. L. (2004). Abstr. Pap. Am. Chem. Soc. 228, U313–U314.  Google Scholar
Return to citationEdman, P. (1960). Ann. N. Y. Acad. Sci. 88, 602–610.  CrossRef PubMed CAS Google Scholar
Return to citationEl Yacoubi, B., Bonnett, S., Anderson, J. N., Swairjo, M. A., Iwata-Reuyl, D. & de Crécy-Lagard, V. (2006). J. Biol. Chem. 281, 37586–37593.  CrossRef PubMed CAS Google Scholar
Return to citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationFischer, M. & Bacher, A. (2005). Nat. Prod. Rep. 22, 324–350.  Web of Science CrossRef PubMed CAS Google Scholar
Return to citationFukushima, K., Richter, W. E. & Shiota, T. (1977). J. Biol. Chem. 252, 5750–5755.  PubMed CAS Google Scholar
Return to citationGranier, S. A., Moubareck, C., Colaneri, C., Lemire, A., Roussel, S., Dao, T.-T., Courvalin, P. & Brisabois, A. (2011). Appl. Environ. Microbiol. 77, 2788–2790.  CrossRef CAS PubMed Google Scholar
Return to citationGräwert, T., Fischer, M. & Bacher, A. (2013). IUBMB Life, 65, 310–322.  PubMed Google Scholar
Return to citationJoosten, R. P., Long, F., Murshudov, G. N. & Perrakis, A. (2014). IUCrJ, 1, 213–220.  Web of Science CrossRef CAS PubMed IUCr Journals Google Scholar
Return to citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationKuzmič, P. (1996). Anal. Biochem. 237, 260–273.  PubMed Web of Science Google Scholar
Return to citationLaemmli, U. K. (1970). Nature (London), 227, 680–685.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationLorber, B. (1997). Clin. Infect. Dis. 24, 1–11.  CrossRef CAS PubMed Google Scholar
Return to citationMaita, N., Okada, K., Hatakeyama, K. & Hakoshima, T. (2002). Proc. Natl Acad. Sci. USA, 99, 1212–1217.  CrossRef PubMed CAS Google Scholar
Return to citationMann, M. & Wilm, M. (1994). Anal. Chem. 66, 4390–4399.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationMullis, K., Faloona, F., Scharf, S., Saiki, R., Horn, G. & Erlich, H. (1986). Cold Spring Harb. Symp. Quant. Biol. 51, 263–273.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationNar, H., Huber, R., Meining, W., Schmid, C., Weinkauf, S. & Bacher, A. (1995). Structure, 3, 459–466.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationNobel Media AB (2014a). Gerhard Domagk – Biographical. http://www.nobelprize.org/nobel_prizes/medicine/laureates/1939/domagk-bio.htmlGoogle Scholar
Return to citationNobel Media AB (2014b). The Nobel Prize in Physiology or Medicine 1988. http://www.nobelprize.org/nobel_prizes/medicine/laureates/1988/press.htmlGoogle Scholar
Return to citationRebelo, J., Auerbach, G., Bader, G., Bracher, A., Nar, H., Hösl, C., Schramek, N., Kaiser, J., Bacher, A., Huber, R. & Fischer, M. (2003). J. Mol. Biol. 326, 503–516.  CrossRef PubMed CAS Google Scholar
Return to citationSchlech, W. F. III & Acheson, D. (2000). Clin. Infect. Dis. 31, 770–775.  CrossRef PubMed Google Scholar
Return to citationStüber, D., Matile, H. & Garotta, G. (1990). Immunological Methods, Vol. IV, edited by I. Lefkovits & B. Pernis, pp. 121–152. New York: Academic Press.  Google Scholar
Return to citationSwarbrick, J., Iliades, P., Simpson, J. S. & Macreadie, I. (2008). Open Enzym. Inhib. J. 1, 12–33.  CrossRef CAS Google Scholar
Return to citationTanaka, Y., Nakagawa, N., Kuramitsu, S., Yokoyama, S. & Masui, R. (2005). J. Biochem. 138, 263–275.  CrossRef PubMed CAS Google Scholar
Return to citationTegeder, I., Costigan, M., Griffin, R. S., Abele, A., Belfer, I., Schmidt, H., Ehnert, C., Nejim, J., Marian, C., Scholz, J., Wu, T., Allchorne, A., Diatchenko, L., Binshtok, A. M., Goldman, D., Adolph, J., Sama, S., Atlas, S. J., Carlezon, W. A., Parsegian, A., Lötsch, J., Fillingim, R. B., Maixner, W., Geisslinger, G., Max, M. B. & Woolf, C. J. (2006). Nature Med. 12, 1269–1277.  Google Scholar
Return to citationWinn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationYim, J. J. & Brown, G. M. (1976). J. Biol. Chem. 251, 5087–5094.  CAS PubMed Google Scholar
Return to citationZhang, J.-H., Chung, T. D. Y. & Oldenburg, K. R. (1999). J. Biomol. Screen. 4, 67–73.  CrossRef PubMed CAS Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds