research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Structure of the substrate-binding domain of Plasmodium falciparum heat-shock protein 70-x

CROSSMARK_Color_square_no_text.svg

aDepartment of Biochemistry, University of Oxford, South Parks Road, Oxford OX1 3QU, United Kingdom
*Correspondence e-mail: [email protected]

Edited by M. W. Bowler, European Molecular Biology Laboratory, France (Received 29 June 2020; accepted 1 September 2020; online 28 September 2020)

The malaria parasite Plasmodium falciparum extensively modifies erythrocytes that it invades by exporting a large complement of proteins to the host cell. Among these exported components is a single heat-shock 70 kDa class protein, PfHsp70-x, that supports the virulence and growth rate of the parasite during febrile episodes. The ATP-binding domain of PfHsp70-x has previously been resolved and showed the presence of potentially druggable epitopes that differ from those on human Hsp70 chaperones. Here, the crystallographic structure of the substrate-binding domain (SBD) of PfHsp70-x is presented in complex with a hydrophobic peptide. The PfHsp70-x SBD is shown to be highly similar to the counterpart from a human erythrocytic Hsp70 chaperone. The binding of substrate at the interface between β-sandwich and α-helical subdomains of this chaperone segment is also conserved between the malaria parasite and humans. It is hypothesized that the parasite may partly exploit human chaperones for intra-erythrocytic trafficking and maintenance of its exported proteome.

1. Introduction

Malaria is an acute febrile illness caused by five different Plasmodium species in humans (World Health Organization, 2019[World Health Organization (2019). World Malaria Report 2019. https://www.who.int/malaria/publications/world-malaria-report-2019/en/.]). Of these, P. falciparum is the most prevalent and dangerous species, accounting for nearly 95% of malaria deaths globally. Key to P. falciparum virulence is the induction of strong cell adhesion in the erythrocytes that it invades, which is a characteristic of this parasite species among human-infective Plasmodia (Craig et al., 2012[Craig, A. G., Khairul, M. F. & Patil, P. R. (2012). Malays. J. Med. Sci. 19, 5-18.]; Smith et al., 2013[Smith, J. D., Rowe, J. A., Higgins, M. K. & Lavstsen, T. (2013). Cell. Microbiol. 15, 1976-1983.]). The adhesion of parasitized erythrocytes to endothelial cells, such as those in the microvasculature lining of the brain, kidneys or placenta, and to other erythrocytes, forming cell clumps, leads to blood-vessel blockage, tissue damage from oxygen deprivation and inflammation, and potentially to coma and death.

Erythrocyte cytoadherence is the result of extensive host-cell remodelling mediated by parasite proteins exported to the host, collectively referred to as the parasite `exportome' (Spillman et al., 2015[Spillman, N. J., Beck, J. R. & Goldberg, D. E. (2015). Annu. Rev. Biochem. 84, 813-841.]). The exported proteins include the P. falciparum erythrocyte membrane protein 1 (PfEMP1) family of adhesion ligands that mediate cell attachment (Hviid & Jensen, 2015[Hviid, L. & Jensen, A. T. (2015). Adv. Parasitol. 88, 51-84.]), members of the Plasmodium helical interspersed sub-telomeric (PHIST) protein family that act as interaction hubs (Warncke et al., 2016[Warncke, J. D., Vakonakis, I. & Beck, H.-P. (2016). Microbiol. Mol. Biol. Rev. 80, 905-927.]), and parasite components that remodel the host membrane and cytoskeleton, create nutrient-permeability pathways and contribute to immune-system evasion (de Koning-Ward et al., 2016[Koning-Ward, T. F. de, Dixon, M. W., Tilley, L. & Gilson, P. R. (2016). Nat. Rev. Microbiol. 14, 494-507.]; Proellocks et al., 2016[Proellocks, N. I., Coppel, R. L., Mohandas, N. & Cooke, B. M. (2016). Adv. Parasitol. 91, 1-86.]; Goldberg & Cowman, 2010[Goldberg, D. E. & Cowman, A. F. (2010). Nat. Rev. Microbiol. 8, 617-621.]). P. falciparum also exports a single heat-shock 70 kDa-class protein chaperone, PfHsp70-x (PF3D7_0831700; Külzer et al., 2012[Külzer, S., Charnaud, S., Dagan, T., Riedel, J., Mandal, P., Pesce, E. R., Blatch, G. L., Crabb, B. S., Gilson, P. R. & Przyborski, J. M. (2012). Cell. Microbiol. 14, 1784-1795.]), to the host cell. Hsp70-class chaperones play key roles across the kingdoms of life in protein quality control, protein translocation, folding and assembly of complexes, and preventing protein aggregation (Boorstein et al., 1994[Boorstein, W. R., Ziegelhoffer, T. & Craig, E. A. (1994). J. Mol. Evol. 38, 1-17.]; Meimaridou et al., 2009[Meimaridou, E., Gooljar, S. B. & Chapple, J. P. (2009). J. Mol. Endocrinol. 42, 1-9.]). PfHsp70-x is found in the parasitophorous vacuole, where it may associate with the PTEX translocation machinery (Zhang et al., 2017[Zhang, Q., Ma, C., Oberli, A., Zinz, A., Engels, S. & Przyborski, J. M. (2017). Sci. Rep. 7, 42188.]), as well as in the host-cell cytoplasm, where it localizes in mobile structures, the `J-dots', together with stimulatory Hsp40-class co-chaperones and the PfEMP1 adhesion ligand (Külzer et al., 2012[Külzer, S., Charnaud, S., Dagan, T., Riedel, J., Mandal, P., Pesce, E. R., Blatch, G. L., Crabb, B. S., Gilson, P. R. & Przyborski, J. M. (2012). Cell. Microbiol. 14, 1784-1795.]). Thus, it is thought that PfHsp70-x assists in PfEMP1 folding and in the assembly of a virulence complex on the erythrocyte membrane that includes PfEMP1. Consistent with this analysis, parasite lines lacking PfHsp70-x exported PfEMP1 less efficiently and were ∼60% less adherent compared with control parasites (Charnaud et al., 2017[Charnaud, S. C., Dixon, M. W. A., Nie, C. Q., Chappell, L., Sanders, P. R., Nebl, T., Hanssen, E., Berriman, M., Chan, J. A., Blanch, A. J., Beeson, J. G., Rayner, J. C., Przyborski, J. M., Tilley, L., Crabb, B. S. & Gilson, P. R. (2017). PLoS One, 12, e0181656.]). Furthermore, in addition to its role in parasite virulence, PfHsp70-x supports cell viability at elevated temperatures, as PfHsp70-x depletion reduced parasite growth by ∼40% during heat shocks comparable to the febrile episodes of malaria patients (Day et al., 2019[Day, J., Passecker, A., Beck, H. P. & Vakonakis, I. (2019). FASEB J. 33, 14611-14624.]). These studies have established PfHsp70-x as a key component for parasite survival and virulence.

The function of Hsp70-class chaperones is linked to the binding of exposed hydrophobic segments of aggregation-prone proteins, `holding' these and facilitating their correct folding in a catalytic cycle driven by ATP hydrolysis (Boorstein et al., 1994[Boorstein, W. R., Ziegelhoffer, T. & Craig, E. A. (1994). J. Mol. Evol. 38, 1-17.]; Meimaridou et al., 2009[Meimaridou, E., Gooljar, S. B. & Chapple, J. P. (2009). J. Mol. Endocrinol. 42, 1-9.]). The Hsp70 structure comprises an N-terminal nucleotide-binding domain (NBD) and a C-terminal substrate-binding domain (SBD) subdivided into twisted β-sandwich (SBDβ) and α-helical lid (SBDα) parts; the NBD and SBD temporarily associate as part of the catalytic cycle, which also includes the opening and closing of the SBDβ/SBDα subdomains to trap the unfolded substrate at their interface. We previously resolved the crystallographic structure of the PfHsp70-x NBD as well as that of the cognate parasite co-chaperone PFA0660w (Day et al., 2019[Day, J., Passecker, A., Beck, H. P. & Vakonakis, I. (2019). FASEB J. 33, 14611-14624.]), which stimulates PfHsp70-x activity (Daniyan et al., 2016[Daniyan, M. O., Boshoff, A., Prinsloo, E., Pesce, E. R. & Blatch, G. L. (2016). PLoS One, 11, e0148517.]), and used these to create a hybrid model of the chaperone–co-chaperone complex that could be compared with human Hsp70 chaperone structures. Here, we report the PfHsp70-x SBD structure in the domain-closed state complexed with a model substrate peptide, used in previous studies of the human Hsp70 and Escherichia coli DnaK SBDs (Zhang et al., 2014[Zhang, P., Leu, J. I.-J., Murphy, M. E., George, D. L. & Marmorstein, R. (2014). PLoS One, 9, e103518.]; Zhu et al., 1996[Zhu, X., Zhao, X., Burkholder, W. F., Gragerov, A., Ogata, C. M., Gottesman, M. E. & Hendrickson, W. A. (1996). Science, 272, 1606-1614.]), that emulates exposed hydrophobic segments of unstructured or misfolded proteins. We show that the PfHsp70-x SBD is highly similar to the human erythrocytic chaperone Hsp70 in structure and mode of substrate binding.

2. Materials and methods

2.1. Macromolecule production

A synthetic, codon-optimized DNA fragment (Integrated DNA Technologies) encoding PfHsp70-x residues 424–650 (PfHsp70-x SDB; UniProt K7NTP5) was cloned in the pFLOAT vector (Rogala et al., 2015[Rogala, K. B., Dynes, N. J., Hatzopoulos, G. N., Yan, J., Pong, S. K., Robinson, C. V., Deane, C. M., Gönczy, P. & Vakonakis, I. (2015). eLife, 4, e07410.]), which provides an N-terminal His6 tag separated from the target protein by a Human rhinovirus (HRV) 3C protease cleavage site (Table 1[link]). The plasmid construct was transformed into Escherichia coli Rosetta 2(DE3) competent cells (Novagen). The transformed E. coli cells were used to inoculate lysogeny broth medium supplemented with appropriate antibiotics and the cells were grown at 37°C to an OD600 of ∼0.6. Protein expression was induced by the addition of a 0.25 mM final concentration of isopropyl β-D-thiogalactopyranoside and was left to proceed at 18°C overnight. The cells were harvested by centrifugation and were resuspended in lysis buffer [500 mM NaCl, 20 mM Na2HPO4 pH 7.2, 0.01%(v/v) Triton X-100]. The cells were lysed by sonication and the lysates were clarified by centrifugation for 60 min at 25 000g.

Table 1
Macromolecule-production information

Source organism P. falciparum
DNA source Synthetic
Cloning vector pFLOAT
Expression vector pFLOAT
Expression host E. coli Rosetta 2(DE3)
Complete amino-acid sequence of the construct produced GPLLDVCPLSLGLETAGGVMTKLIERNTTIPTKKNQIFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFQLEGIPPAPRSVPQIEVTFDIDANGILNVTALDKGTGKQNQITITNDKGRLSKDDIDRMVNDAEKYKEEDEQNKNRIEARNNLENYCYNVKNTLQDENLKTKIPKDDSEKCMKTVKSVLDWLEKNQTAETEEYNEKEKDISSVYNPIMTKIYQGASAQE

The clarified cell supernatants were loaded onto metal-affinity HiTrap Talon columns (GE Healthcare Life Sciences) equilibrated in lysis buffer. The columns were washed using lysis buffer supplemented with 10 mM imidazole and the proteins were eluted using a gradient of imidazole concentration to 500 mM. Protein-containing fractions were pooled and dialysed against 3C cleavage buffer [50 mM NaCl, 20 mM Na2HPO4 pH 7.2, 1 mM dithiothreitol (DTT)] prior to overnight incubation with recombinant HRV 3C protease engineered with a noncleavable His6 tag. The HRV 3C protease was removed by a reverse metal-affinity step using a HiTrap Talon column, with PfHsp70-x SBD in the column flowthrough. The PfHsp70-x SBD samples were then loaded onto an ion-exchange HiTrap Q column (GE Healthcare Life Sciences) equilibrated in 3C cleavage buffer and eluted using a NaCl gradient to a concentration of 500 mM. Protein samples were concentrated by centrifugal ultrafiltration using Amicon Ultra 10 kDa cutoff devices (Merck Millipore) and were loaded onto a Superdex 75 16/600 HiLoad column (GE Healthcare Life Sciences) equilibrated in crystallization buffer [150 mM NaCl, 20 mM 4-(2-hydroxyethyl)-1-piperazine­ethanesulfonic acid (HEPES) pH 7.2, 1 mM DTT]. The protein-containing samples were pooled and concentrated as described above.

The protein quality was analysed by SDS–PAGE. The protein concentration was estimated by UV absorption at 280 nm using a Nanodrop spectrophotometer (Thermo Scientific) and a modified extinction coefficient calculated from the expected amino-acid sequence (Pace et al., 1995[Pace, C. N., Vajdos, F., Fee, L., Grimsley, G. & Gray, T. (1995). Protein Sci. 4, 2411-2423.]). All chemicals were purchased from Sigma–Aldrich unless otherwise noted.

2.2. Crystallization

A synthetically produced heptapeptide with the sequence N1RLLLTG7 (GL Biochem, Shanghai, People's Republic of China) was dissolved directly in crystallization buffer. Crystallization samples formulated in the same buffer were composed of PfHsp70-x SBD and this peptide at final concentrations of 10 mg ml−1 and 5 mM, respectively. Samples were incubated for 15 min at 42°C, gradually cooled to room temperature and centrifuged at 15 000g for 5 min prior to crystallization-drop setup using the sitting-drop vapour-diffusion method. Crystallization drops of 200 nl final volume were set up using a Mosquito robot (TTP Labtech) and a 1:1 ratio of protein-containing solution to mother liquor (Table 2[link]). Diffracting crystals developed after incubation at 20°C for three days with a mother liquor consisting of 0.1 M bicine/2-­amino-2-(hydroxymethyl)propane-1,3-diol (Trizma) base pH 8.5, 10%(w/v) polyethylene glycol (PEG) 20 000, 20%(w/v) PEG MME 550 and 0.03 M each of an ethylene glycol mixture (diethylene glycol to pentaethylene glycol).

Table 2
Crystallization

Method Sitting-drop vapour diffusion
Temperature (K) 293
Protein concentration 10 mg ml−1 protein + 5 mM NRLLLTG peptide
Buffer composition of protein solution 150 mM NaCl, 20 mM HEPES pH 7.2, 1 mM DTT
Composition of reservoir solution 0.1 M bicine/Trizma base pH 8.5, 10%(w/v) PEG 20 000, 20%(w/v) PEG MME 550, 0.03 M of each of diethylene glycol to pentaethylene glycol
Volume and ratio of drop 200 nl, 1:1 protein:mother liquor
Volume of reservoir (µl) 40

2.3. Data collection and processing

Diffraction data were collected on beamline I03 at Diamond Light Source, Harwell, UK to a resolution of 3.25 Å. Diffraction data were processed with xia2 in DIALS (Winter, 2010[Winter, G. (2010). J. Appl. Cryst. 43, 186-190.]; Winter et al., 2018[Winter, G., Waterman, D. G., Parkhurst, J. M., Brewster, A. S., Gildea, R. J., Gerstel, M., Fuentes-Montero, L., Vollmar, M., Michels-Clark, T., Young, I. D., Sauter, N. K. & Evans, G. (2018). Acta Cryst. D74, 85-97.]). The space group was determined to be P1211, with four copies per asymmetric unit (data statistics are given in Table 3[link]).

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source Beamline I03, Diamond Light Source
Wavelength (Å) 0.9793
Temperature (K) 100
Detector PILATUS3 6M, Dectris
Rotation range per image (°) 0.1
Total rotation range (°) 360
Exposure time per image (s) 0.01
Space group P21
a, b, c (Å) 71.07, 93.85, 85.30
α, β, γ (°) 90, 99.47, 90
Resolution range (Å) 93.85–3.25 (3.31–3.25)
Total No. of reflections 120016 (5297)
No. of unique reflections 17457 (796)
Completeness (%) 99.8 (94.1)
Multiplicity 6.9 (6.7)
I/σ(I)〉 8.7 (1.5)
Rp.i.m. 0.048 (0.777)
CC1/2 0.997 (0.568)
Overall B factor from Wilson plot (Å2) 94.35

2.4. Structure solution, refinement and analysis

The structure was solved by molecular replacement using Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) with a single copy of the human Hsp70 SBD (PDB entry 4po2; Zhang et al., 2014[Zhang, P., Leu, J. I.-J., Murphy, M. E., George, D. L. & Marmorstein, R. (2014). PLoS One, 9, e103518.]) from which the substrate peptide had been removed as a molecular-replacement model. Iterative cycles of refinement and model building were performed using BUSTER (Bricogne et al., 2017[Bricogne, G., Blanc, E., Brandl, M., Flensburg, C., Keller, P., Paciorek, W., Roversi, P., Sharff, A., Smart, O. S., Vonrhein, C. & Womack, T. O. (2017). BUSTER. Global Phasing Ltd, Cambridge, UK.]) and Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]), respectively (statistics are given in Table 4[link]). Figures were prepared using PyMOL (DeLano, 2002[DeLano, W. L. (2002). PyMOL. https://www.pymol.org.]). Analysis of complex interfaces was performed by PDBePISA (Krissinel & Henrick, 2007[Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774-797.]). Sequence alignments were performed by Clustal Omega (Madeira et al., 2019[Madeira, F., Park, Y. M., Lee, J., Buso, N., Gur, T., Madhusoodanan, N., Basutkar, P., Tivey, A. R. N., Potter, S. C., Finn, R. D. & Lopez, R. (2019). Nucleic Acids Res. 47, W636-W641.]).

Table 4
Structure refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 84.13–3.25 (3.28–3.25)
Completeness (%) 99.7
σ Cutoff F > 0.000σ(F)
No. of reflections, working set 17437 (399)
No. of reflections, test set 843
Final Rcryst 0.297 (0.289)
Final Rfree 0.321 (0.299)
No. of non-H atoms
 Protein 7012
 Ligand 0
 Water 0
R.m.s. deviations
 Bonds (Å) 0.009
 Angles (°) 1.12
Average B factors (Å2) 152.5
Protein geometry
 Ramachandran favoured (%) 99.54
 Ramachandran disallowed (%) 0.00
Favoured rotamers (%) 99.5
Poor rotamers (%) 0.00
MolProbity clashscore, all atoms 15.1
MolProbity clashscore, percentile 97th
MolProbity score 1.68
MolProbity score, percentile 100th

3. Results and discussion

3.1. Structure of the PfHsp70-x SBD–substrate complex

The asymmetric unit of the PfHsp70-x SBD–substrate crystals comprised four copies of the complex, with each protomer adopting the characteristic SBDβ/SBDα subdomain architecture of Hsp70 SBDs (Fig. 1[link]a). PfHsp70-x SBDβ (residues 424–539) is made up of eight β-strands arranged into two β-sheets of four antiparallel strands, and is connected by a short loop, Lα,β, to SBDα (residues 540–644). SBDα consists of five α-helices, which first cape SBDβ and are then arranged into a C-terminal antiparallel three-helical bundle. In this manner, SBDα forms a helical lid across SBDβ, thereby potentially regulating access to the substrate-binding site (see below). The contact between the SBDβ and SBDα subdomains showed that our crystallographic structure corresponds to the closed state of this substrate-binding module. The four PfHsp70-x SBD monomers in the asymmetric unit were structurally similar, with an average pairwise Cα root-mean-square deviation (r.m.s.d.) of 2.19 Å (215 aligned atoms with no outlier rejections; Fig. 1[link]a); however, the similarity was significantly more pronounced within the SBD subdomains (SBDβ, 0.76 Å average pairwise Cα r.m.s.d. for 105 aligned atoms, Fig. 1[link]b; SBDα, 1.12 Å average pairwise Cα r.m.s.d. for 104 aligned atoms, Fig. 1[link]c). This suggested that the greatest plasticity of PfHsp70-x SBD manifests in the relative positioning of SBDβ and SBDα, which is consistent with these two subdomains being mobile relative to each other as part of the chaperone catalytic cycle.

[Figure 1]
Figure 1
Structure of the PfHsp70-x SBD–substrate complex. (a) Superposition of the four complex copies in the asymmetric unit of the crystal, showing the protein architecture comprising SBDβ and SBDα subdomains. The substrate peptide (N1RLLLTG7) is shown as sticks. (b, c) Close-up views of the SBDβ and SBDα subdomains, respectively. SBDβ β-strand-connecting loops and SBDα helices are enumerated.

The PfHsp70-x SBDβ harboured the substrate-binding site primarily between loops L1,2 and L3,4 (Fig. 2[link]a), which defined a hydrophobic groove. Residues Ala437 and Tyr462 of L1,2 and L3,4, respectively, formed an arch over this groove, thereby inhibiting substrate release (Fig. 2[link]b). All four copies of PfHsp70-x SBD in the asymmetric unit were complexed with a substrate peptide with sequence N1RLLLTG7; in three of the complexes all seven peptide residues could be resolved (Fig. 2[link]a), while only four residues (Leu4–Gly7) could be built for the last copy of the complex. Substrate binding was stabilized by the burial of Leu5 of the peptide in a hydrophobic pocket formed by Leu434, Phe459, Val469, Ile471, Ile505 and Val507 of SBDβ (Fig. 2[link]c), as well as additional hydrophobic interactions between Leu4 and Thr6 of the the peptide and the Ala437–Tyr462 arch of SBDβ (Fig. 2[link]b). Although the low resolution of this structure limits the accuracy with which hydrogen bonds can be inferred, we note that up to eight such bonds may form between the peptide Leu3–Gly7 backbone atoms and the SBDβ backbone (Ala437, Thr460, Tyr462 and Leu470) or side-chain (Gln466 and Gln 491) moieties (Fig. 2[link]d). Complex formation buried ∼567 Å2 of solvent-accessible surface area on average in the three PfHsp70-x SBD–substrate copies where all peptide residues could be resolved; thus, the complex interface accounts for nearly 50% of the total accessible peptide area. However, it should be noted that the NRLLLTG model peptide may not capture all of the interactions formed by the true substrates of the PfHsp70-x SBD.

[Figure 2]
Figure 2
Substrate recognition by PfHsp70-x SBD. (a) Electron-density (2FoFc) OMIT map of the substrate peptide bound to PfHsp70-x SBD. The map was contoured at 1σ. The protein loops L1,2 and L3,4, which define the substrate-binding groove, are indicated. The substrate peptide, which is shown as a reference but was not included in the map calculations, is represented as sticks. (b) The Ala437–Tyr462 arch forming over the substrate-binding groove is shown. The side chains of the protein residues forming this arch are denoted as spheres. (c) Surface representation of the PfHsp70-x SBD hydrophobic cavity where the peptide L5 (side chain shown as spheres) docks. The surfaces of the protein residues that are directly involved in L5 binding are coloured light blue. (d) Hydrogen bonds inferred between the substrate peptide and PfHsp70-x SBD. Protein residues participating in hydrogen bonds are shown as sticks and coloured light blue. Hydrogen bonds are shown as dashed yellow lines.

3.2. Comparison of PfHsp70-x SBD with other Hsp70s

Comparison of SBDs from Hsp70 homologues revealed a high level of amino-acid sequence identity (Supplementary Fig. S1), in particular for SBDβ. Crucially, the residues of the hydrophobic substrate-binding interface were nearly identical in human erythrocytic Hsp70s (Hsp70 and Hsc70; Bryk & Wiśniewski, 2017[Bryk, A. H. & Wiśniewski, J. R. (2017). J. Proteome Res. 16, 2752-2761.]) and PfHsp70-x, and also in the more sequence-remote E. coli DnaK. However, Ala437 and Tyr462 of PfHsp70-x, which form the substrate arch in SBDβ, were identical in human chaperones, but their relative size was reversed (Met instead of Ala and Ala instead of Tyr) in DnaK. This reversal of amino-acid size in PfHsp70-x versus bacterial DnaK was previously recognized from the amino-acid sequence and may impact substrate specificity and release (Shonhai et al., 2007[Shonhai, A., Boshoff, A. & Blatch, G. L. (2007). Protein Sci. 16, 1803-1818.]; Zhu et al., 1996[Zhu, X., Zhao, X., Burkholder, W. F., Gragerov, A., Ogata, C. M., Gottesman, M. E. & Hendrickson, W. A. (1996). Science, 272, 1606-1614.]). Further, the Lα,β loop was identical in the erythrocytic and P. falciparum chaperones, while it differed in the equivalent segment of DnaK by having larger amino acids (–TNDK– compared with –ASSG–) and being one residue longer. As opening and closing motions of the SBDβ/SBDα subdomains along the Lα,β loop have been shown to affect substrate binding and chaperone activity (Zhuravleva et al., 2012[Zhuravleva, A., Clerico, E. M. & Gierasch, L. M. (2012). Cell, 151, 1296-1307.]; Kityk et al., 2012[Kityk, R., Kopp, J., Sinning, I. & Mayer, M. P. (2012). Mol. Cell, 48, 863-874.]), we concluded that PfHsp70-x SBD is likely to be functionally closer to its human erythrocytic counterparts than the prokaryotic chaperone.

The extent of the similarity of PfHsp70-x SBD to the human chaperones was underscored by structural comparisons. Superposition of the SBDs of human Hsp70 (PDB entry 4po2; Zhang et al., 2014[Zhang, P., Leu, J. I.-J., Murphy, M. E., George, D. L. & Marmorstein, R. (2014). PLoS One, 9, e103518.]), DnaK (PDB entry 1dkz; Zhu et al., 1996[Zhu, X., Zhao, X., Burkholder, W. F., Gragerov, A., Ogata, C. M., Gottesman, M. E. & Hendrickson, W. A. (1996). Science, 272, 1606-1614.]) and PfHsp70-x revealed broadly similar three-dimensional structures (Fig. 3[link]). Nevertheless, alignment of the PfHsp70-x SBD with that of human Hsp70 showed a Cα r.m.s.d. of 2.45 Å on average (219 atoms aligned), whereas comparison of PfHsp70-x SBD with DnaK revealed a Cα r.m.s.d. of 3.03 Å (212 atoms aligned). Thus, the SBD of PfHsp70-x is structurally more similar to that of human Hsp70 than to E. coli DnaK. However, it is worth noting that the complexed state of Hsp70 SBD domains is generally structurally conserved, with an average Cα r.m.s.d. of only ∼1.3 Å seen in comparisons of DnaK, E. coli HscA (PDB entry 1u00; Cupp-Vickery et al., 2004[Cupp-Vickery, J. R., Peterson, J. C., Ta, D. T. & Vickery, L. E. (2004). J. Mol. Biol. 342, 1265-1278.]), human Hsp70 and bovine Hsc70 (PDB entry 3c7n; Schuermann et al., 2008[Schuermann, J. P., Jiang, J., Cuellar, J., Llorca, O., Wang, L., Gimenez, L. E., Jin, S., Taylor, A. B., Demeler, B., Morano, K. A., Hart, P. J., Valpuesta, J. M., Lafer, E. M. & Sousa, R. (2008). Mol. Cell, 31, 232-243.]).

[Figure 3]
Figure 3
Comparison of PfHsp70-x SBD with homologues. Shown here is a structural superposition of PfHsp70-x SBD (blue) with the equivalent domains of human Hsp70 (red; PDB entry 4po2; Zhang et al., 2014[Zhang, P., Leu, J. I.-J., Murphy, M. E., George, D. L. & Marmorstein, R. (2014). PLoS One, 9, e103518.]) and E. coli DnaK (wheat; PDB entry 1dkz; Zhu et al., 1996[Zhu, X., Zhao, X., Burkholder, W. F., Gragerov, A., Ogata, C. M., Gottesman, M. E. & Hendrickson, W. A. (1996). Science, 272, 1606-1614.]). PfHsp70-x SBD is substantially similar to both of these domains; however, it is structurally closer to the human chaperone than to the prokaryotic counterpart.

In conclusion, here we report the first crystallographic structure of the substrate-binding domain of PfHsp70-x. Analysis of the structure, and of the way in which a model substrate peptide was bound, suggested that PfHsp70-x adopts a canonical Hsp70-class chaperone SBD architecture. However, the PfHsp70-x SBD was more similar to those of human chaperones, such as those found in the erythrocyte, than to a prokaryotic counterpart. Although substrate selectivity depends on cross-talk between the Hsp70 SBD and ATP-binding domains (Swain et al., 2007[Swain, J. F., Dinler, G., Sivendran, R., Montgomery, D. L., Stotz, M. & Gierasch, L. M. (2007). Mol. Cell, 26, 27-39.]; Vogel et al., 2006[Vogel, M., Mayer, M. P. & Bukau, B. (2006). J. Biol. Chem. 281, 38705-38711.]), which cannot be evaluated by the SBD structure alone, on the basis of similarities between the human Hsp70 and parasite Hsp70-x SBDs we propose that the parasite may be able to use human chaperones to supplement PfHsp70-x function, for example in maintaining the structure of parasite components exported to the host cell or for trafficking PfEMP1. Such a supplementary role of human Hsp70s may explain why the deletion or depletion of PfHsp70-x has only a partial impact on parasite survival and virulence (Charnaud et al., 2017[Charnaud, S. C., Dixon, M. W. A., Nie, C. Q., Chappell, L., Sanders, P. R., Nebl, T., Hanssen, E., Berriman, M., Chan, J. A., Blanch, A. J., Beeson, J. G., Rayner, J. C., Przyborski, J. M., Tilley, L., Crabb, B. S. & Gilson, P. R. (2017). PLoS One, 12, e0181656.]; Day et al., 2019[Day, J., Passecker, A., Beck, H. P. & Vakonakis, I. (2019). FASEB J. 33, 14611-14624.]).

Footnotes

Current address: Department of Biochemistry, Julius-Maximilians-Universität Würzburg, Sanderring 2, 97070 Würzburg, Germany.

Acknowledgements

We thank Anastassia Kantsadi and Nada Mohamad for helpful discussions, Jemma Day for the PfHsp70-x SBD genetic construct and Edward Lowe for maintenance of the Oxford Biochemistry crystallization facility. We thank Diamond Light Source for the provision of synchrotron-radiation facilities.

Funding information

Funding for this research was provided by: Medical Research Council (grant No. MR/N009274/1 to Ioannis Vakonakis); European Commission, Erasmus+ (studentship to Julia Schmidt).

References

First citationBoorstein, W. R., Ziegelhoffer, T. & Craig, E. A. (1994). J. Mol. Evol. 38, 1–17.  CrossRef CAS PubMed Google Scholar
First citationBricogne, G., Blanc, E., Brandl, M., Flensburg, C., Keller, P., Paciorek, W., Roversi, P., Sharff, A., Smart, O. S., Vonrhein, C. & Womack, T. O. (2017). BUSTER. Global Phasing Ltd, Cambridge, UK.  Google Scholar
First citationBryk, A. H. & Wiśniewski, J. R. (2017). J. Proteome Res. 16, 2752–2761.  CrossRef CAS PubMed Google Scholar
First citationCharnaud, S. C., Dixon, M. W. A., Nie, C. Q., Chappell, L., Sanders, P. R., Nebl, T., Hanssen, E., Berriman, M., Chan, J. A., Blanch, A. J., Beeson, J. G., Rayner, J. C., Przyborski, J. M., Tilley, L., Crabb, B. S. & Gilson, P. R. (2017). PLoS One, 12, e0181656.  CrossRef PubMed Google Scholar
First citationCraig, A. G., Khairul, M. F. & Patil, P. R. (2012). Malays. J. Med. Sci. 19, 5–18.  PubMed Google Scholar
First citationCupp-Vickery, J. R., Peterson, J. C., Ta, D. T. & Vickery, L. E. (2004). J. Mol. Biol. 342, 1265–1278.  Web of Science CrossRef PubMed CAS Google Scholar
First citationDaniyan, M. O., Boshoff, A., Prinsloo, E., Pesce, E. R. & Blatch, G. L. (2016). PLoS One, 11, e0148517.  CrossRef PubMed Google Scholar
First citationDay, J., Passecker, A., Beck, H. P. & Vakonakis, I. (2019). FASEB J. 33, 14611–14624.  CrossRef PubMed Google Scholar
First citationDeLano, W. L. (2002). PyMOL. https://www.pymol.orgGoogle Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationGoldberg, D. E. & Cowman, A. F. (2010). Nat. Rev. Microbiol. 8, 617–621.  CrossRef CAS PubMed Google Scholar
First citationHviid, L. & Jensen, A. T. (2015). Adv. Parasitol. 88, 51–84.  CrossRef PubMed Google Scholar
First citationKityk, R., Kopp, J., Sinning, I. & Mayer, M. P. (2012). Mol. Cell, 48, 863–874.  CrossRef CAS PubMed Google Scholar
First citationKoning-Ward, T. F. de, Dixon, M. W., Tilley, L. & Gilson, P. R. (2016). Nat. Rev. Microbiol. 14, 494–507.  PubMed Google Scholar
First citationKrissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774–797.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKülzer, S., Charnaud, S., Dagan, T., Riedel, J., Mandal, P., Pesce, E. R., Blatch, G. L., Crabb, B. S., Gilson, P. R. & Przyborski, J. M. (2012). Cell. Microbiol. 14, 1784–1795.  PubMed Google Scholar
First citationMadeira, F., Park, Y. M., Lee, J., Buso, N., Gur, T., Madhusoodanan, N., Basutkar, P., Tivey, A. R. N., Potter, S. C., Finn, R. D. & Lopez, R. (2019). Nucleic Acids Res. 47, W636–W641.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMeimaridou, E., Gooljar, S. B. & Chapple, J. P. (2009). J. Mol. Endocrinol. 42, 1–9.  CrossRef PubMed CAS Google Scholar
First citationPace, C. N., Vajdos, F., Fee, L., Grimsley, G. & Gray, T. (1995). Protein Sci. 4, 2411–2423.  CrossRef CAS PubMed Web of Science Google Scholar
First citationProellocks, N. I., Coppel, R. L., Mohandas, N. & Cooke, B. M. (2016). Adv. Parasitol. 91, 1–86.  CrossRef PubMed Google Scholar
First citationRogala, K. B., Dynes, N. J., Hatzopoulos, G. N., Yan, J., Pong, S. K., Robinson, C. V., Deane, C. M., Gönczy, P. & Vakonakis, I. (2015). eLife, 4, e07410.  CrossRef PubMed Google Scholar
First citationSchuermann, J. P., Jiang, J., Cuellar, J., Llorca, O., Wang, L., Gimenez, L. E., Jin, S., Taylor, A. B., Demeler, B., Morano, K. A., Hart, P. J., Valpuesta, J. M., Lafer, E. M. & Sousa, R. (2008). Mol. Cell, 31, 232–243.  Web of Science CrossRef PubMed CAS Google Scholar
First citationShonhai, A., Boshoff, A. & Blatch, G. L. (2007). Protein Sci. 16, 1803–1818.  CrossRef PubMed CAS Google Scholar
First citationSmith, J. D., Rowe, J. A., Higgins, M. K. & Lavstsen, T. (2013). Cell. Microbiol. 15, 1976–1983.  CrossRef CAS PubMed Google Scholar
First citationSpillman, N. J., Beck, J. R. & Goldberg, D. E. (2015). Annu. Rev. Biochem. 84, 813–841.  CrossRef CAS PubMed Google Scholar
First citationSwain, J. F., Dinler, G., Sivendran, R., Montgomery, D. L., Stotz, M. & Gierasch, L. M. (2007). Mol. Cell, 26, 27–39.  Web of Science CrossRef PubMed CAS Google Scholar
First citationVogel, M., Mayer, M. P. & Bukau, B. (2006). J. Biol. Chem. 281, 38705–38711.  CrossRef PubMed CAS Google Scholar
First citationWarncke, J. D., Vakonakis, I. & Beck, H.-P. (2016). Microbiol. Mol. Biol. Rev. 80, 905–927.  CrossRef CAS PubMed Google Scholar
First citationWinter, G. (2010). J. Appl. Cryst. 43, 186–190.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationWinter, G., Waterman, D. G., Parkhurst, J. M., Brewster, A. S., Gildea, R. J., Gerstel, M., Fuentes-Montero, L., Vollmar, M., Michels-Clark, T., Young, I. D., Sauter, N. K. & Evans, G. (2018). Acta Cryst. D74, 85–97.  Web of Science CrossRef IUCr Journals Google Scholar
First citationWorld Health Organization (2019). World Malaria Report 2019. https://www.who.int/malaria/publications/world-malaria-report-2019/en/Google Scholar
First citationZhang, P., Leu, J. I.-J., Murphy, M. E., George, D. L. & Marmorstein, R. (2014). PLoS One, 9, e103518.  CrossRef PubMed Google Scholar
First citationZhang, Q., Ma, C., Oberli, A., Zinz, A., Engels, S. & Przyborski, J. M. (2017). Sci. Rep. 7, 42188.  CrossRef PubMed Google Scholar
First citationZhu, X., Zhao, X., Burkholder, W. F., Gragerov, A., Ogata, C. M., Gottesman, M. E. & Hendrickson, W. A. (1996). Science, 272, 1606–1614.  CrossRef CAS PubMed Web of Science Google Scholar
First citationZhuravleva, A., Clerico, E. M. & Gierasch, L. M. (2012). Cell, 151, 1296–1307.  CrossRef CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds