research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
ADDENDA AND ERRATA
A correction has been published for this article. To view the correction, click here.

Crystal structure of a hypothetical protein from Giardia lamblia

crossmark logo

aDepartment of Chemistry and Biochemistry, Hampton University, 100 William R. Harvey Way, Hampton, VA 23668, USA, bSeattle Structural Genomics Center for Infectious Disease (SSGCID), Seattle, Washington, USA, cCenter for Infectious Disease Research, formerly Seattle Biomedical Research Institute, 307 Westlake Avenue North Suite 500, Seattle, WA 98109, USA, and dLabcorp Drug Development Inc., Princeton, NJ 08540, USA
*Correspondence e-mail: [email protected]

Edited by F. T. Tsai, Baylor College of Medicine, Houston, USA (Received 13 October 2021; accepted 23 December 2021; online 28 January 2022)

Giardiasis is the most prevalent diarrheal disease globally and affects humans and animals. It is a significant problem in developing countries, the number one cause of travelers' diarrhea and affects children and immunocompromised individuals, especially HIV-infected individuals. Giardiasis is treated with antibiotics (tinidazole and metronidazole) that are also used for other infections such as trichomoniasis. The ongoing search for new therapeutics for giardiasis includes characterizing the structure and function of proteins from the causative protozoan Giardia lamblia. These proteins include hypothetical proteins that share 30% sequence identity or less with proteins of known structure. Here, the atomic resolution structure of a 15.6 kDa protein was determined by molecular replacement. The structure has the two-layer αβ-sandwich topology observed in the prototypical endoribonucleases L-PSPs (liver perchloric acid-soluble proteins) with conserved allosteric active sites containing small molecules from the crystallization solution. This article is an educational collaboration between Hampton University and the Seattle Structural Genomics Center for Infectious Disease.

1. Introduction

The flagellated protozoa Giardia lamblia is the most commonly identified intestinal parasite globally, causing giardiasis, otherwise known as travelers' diarrhea (Daniels et al., 2015[Daniels, M. E., Shrivastava, A., Smith, W. A., Sahu, P., Odagiri, M., Misra, P. R., Panigrahi, P., Suar, M., Clasen, T. & Jenkins, M. W. (2015). Am. J. Trop. Med. Hyg. 93, 596-600.]; Escobedo et al., 2015[Escobedo, A. A., Arencibia, R., Vega, R. L., Rodríguez-Morales, A. J., Almirall, P. & Alfonso, M. (2015). J. Infect. Dev. Ctries, 9, 76-86.]). Giardiasis is a zoonotic infection, and Giardia species have been isolated from the stools of vertebrates, including mammals, amphibians and birds (Thompson, 2013[Thompson, R. C. (2013). Int. J. Parasitol. 43, 1079-1088.]). Giardia is an endemic neglected tropical disease, and outbreaks of giardiasis from contaminated water or food sources are common in developing countries because of poor sanitation (McIntyre et al., 2014[McIntyre, K. M., Setzkorn, C., Wardeh, M., Hepworth, P. J., Radford, A. D. & Baylis, M. (2014). Prev. Vet. Med. 116, 325-335.]). It only takes ∼10 Giardia cysts to cause infection, and in developed countries giardiasis is more common among children and hospital patients, especially immunocompromised individuals and institutionalized patients (Huang & White, 2006[Huang, D. B. & White, A. C. (2006). Gastroenterol. Clin. North Am. 35, 291-314.]). The current standard treatment for giardiasis is antibiotic therapy using tinidazole and metronidazole (Lobovská & Nohýnková, 2003[Lobovská, A. & Nohýnková, E. (2003). Cas. Lek. Cesk. 142, 177-181.]). Characterizing the structures and functions of G. lamblia proteins is the first step towards identifying new therapeutics for giardiasis.

G. lamblia is one of the organisms selected by the Seattle Structural Genomics Center for Infectious Disease (SSGCID) for high-throughput structural studies, and hypothetical proteins have been identified with limited sequence similarity to proteins of known function. One of these hypothetical proteins is a 141-amino-acid protein (UniProt ID A8BD71, XP_001707732.1). This protein shares over 30% sequence identity and 50% coverage with only two unique proteins in the Protein Data Bank. One of these proteins is a putative endonuclease from Entamoeba histolytica (PDB entries 3mqw, 3m1x and 3m4s; 36% sequence identity and 56% coverage; Seattle Structural Genomics Center for Infectious Disease, unpublished work). The other comprises the amino-terminal residues 13–121 of Saccharomyces cerevisiae mitochondrial matrix protein Mmf1 (PDB entry 3quw), with 30% sequence identity and 77% coverage (Pu et al., 2011[Pu, Y.-G., Jiang, Y.-L., Ye, X.-D., Ma, X.-X., Guo, P.-C., Lian, F.-M., Teng, Y.-B., Chen, Y. & Zhou, C.-Z. (2011). J. Struct. Biol. 175, 469-474.]). A BLAST search against all redundant Giardia sequences reveals three proteins that share appreciable sequence similarity with this hypo­thetical protein: EFO62390.1, the hypothetical protein GLP15_656 from G. lamblia P15, EET01624.1, the hypo­thetical protein GL50581_1093 from G. intestinalis ATCC 50581, and ESU43034.1, a putative YjgF/YER057c/UK114 family protein from G. intestinalis (Fig. 1[link]). Here, we present the atomic resolution crystal structure of this hypothetical protein as a first step towards clarifying its possible functions.

[Figure 1]
Figure 1
Structural and primary-sequence alignment of the hypothetical protein from G. lamblia (GilaA.00312.a) with EFO62390.1, the hypothetical protein GLP15_656 from G. lamblia P15, EET01624.1, the hypothetical protein GL50581_1093 from G. intestinalis ATCC 50581, and ESU43034.1, a putative YjgF/YER057c/UK114 family protein from G. intestinalis. The secondary-structure elements shown are α-helices (α), 310-helices (η), β-strands (β) and β-turns (TT). Identical residues are shown in white on a red background and conserved residues are shown in red. This figure was generated using ESPript (Gouet et al., 1999[Gouet, P., Courcelle, E., Stuart, D. I. & Métoz, F. (1999). Bioinformatics, 15, 305-308.], 2003[Gouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320-3323.]).

2. Materials and methods

2.1. Macromolecule production

The protein was cloned, expressed and purified following standard protocols of the Seattle Structural Genomics Center for Infectious Disease (SSGCID; Bryan et al., 2011[Bryan, C. M., Bhandari, J., Napuli, A. J., Leibly, D. J., Choi, R., Kelley, A., Van Voorhis, W. C., Edwards, T. E. & Stewart, L. J. (2011). Acta Cryst. F67, 1010-1014.]; Choi et al., 2011[Choi, R., Kelley, A., Leibly, D., Nakazawa Hewitt, S., Napuli, A. & Van Voorhis, W. (2011). Acta Cryst. F67, 998-1005.]; Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]). Briefly, genomic DNA from G. lamblia GL50803_14299 was provided by Dr Ethan Merritt, University of Washington. DNA encoding amino acids 1–141 (UniProt A8BD71) of G. lamblia GL50803_14299 was PCR-amplified from genomic DNA using the primers shown in Table 1[link]. The PCR product was cloned into expression vector pAVA0421 (Choi et al., 2011[Choi, R., Kelley, A., Leibly, D., Nakazawa Hewitt, S., Napuli, A. & Van Voorhis, W. (2011). Acta Cryst. F67, 998-1005.]) by ligation-independent cloning (LIC; Aslanidis & de Jong, 1990[Aslanidis, C. & de Jong, P. J. (1990). Nucleic Acids Res. 18, 6069-6074.]). The final expression vector includes a cleavable 6×His fusion tag followed by the human rhinovirus 3C protease-cleavage sequence (MAHHHHHHMGTLEAQTQGPGS-ORF). The underlined glutamine (Q) and glycine (G) residues denote the 3C cleavage site. Plasmid DNA was transformed into chemically competent Escherichia coli BL21(DE3)R3 Rosetta cells. The cells were tested for expression and 2 l of culture was grown using auto-induction medium (Studier, 2005[Studier, F. W. (2005). Protein Expr. Purif. 41, 207-234.]) in a LEX Bioreactor (Epiphyte Three Inc.). The expression clone was assigned the SSGCID target identifier GilaA.00312.a.

Table 1
Macromolecule-production information

Source organism Giardia lamblia GL50803_14299
DNA source Genomic DNA from Dr Ethan A. Merritt, University of Washington
Forward primer GGGTCCTGGTTCGATGTTGACGGACTATCGCATCCG
Reverse primer CTTGTTCGTGCTGTTTATTATACGAGGATGGTCCAGCAATCG
Cloning vector pAVA0421
Expression vector pAVA0421
Expression host E. coli BL21(DE3)R3 Rosetta
Complete amino-acid sequence of the construct produced MAHHHHHHMGTLEAQTQGPGSMIYGILSKNLGMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLSTSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK
Amino-acid sequence after 3C protease cleavage GPGSMIYGILSKNLGMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLSTSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK

Both the expression clone and purified protein are available at https://www.ssgcid.org/available-materials/.

The recombinant protein was purified using a four-step protocol consisting of an Ni2+-affinity chromatography (IMAC) step, cleavage of the N-terminal histidine tag with 3C protease, reverse capture with a second Ni2+-affinity chromatography column and size-exclusion chromatography (SEC). All chromatography runs were performed on an ÄKTA­purifier 10 (GE) using automated IMAC and SEC programs according to previously described procedures (Bryan et al., 2011[Bryan, C. M., Bhandari, J., Napuli, A. J., Leibly, D. J., Choi, R., Kelley, A., Van Voorhis, W. C., Edwards, T. E. & Stewart, L. J. (2011). Acta Cryst. F67, 1010-1014.]). The final SEC was performed on a HiLoad 26/600 Superdex 75 column (GE Healthcare) using a mobile phase consisting of 500 mM NaCl, 25 mM HEPES, 5% glycerol, 0.025% azide, 2 mM DTT pH 7.0. Peak fractions were pooled and analyzed using SDS–PAGE. The peak fractions were concentrated to 30.5 mg ml−1 using an Amicon purification system (Millipore). Aliquots of 200 µl were flash-frozen in liquid nitrogen and stored at −80°C until use for crystallization.

2.2. Crystallization

Crystals were grown following established crystallization approaches at the SSGCID. Briefly, recombinant GilaA.00312.a was diluted to 13.46 mg ml−1. Protein concentration was assessed using the OD280 with a molar extinction coefficient of 7450 M−1 cm−1. Single crystals were obtained by vapor diffusion in sitting drops using equal volumes of protein solution and precipitant solution equilibrated against a reservoir containing precipitant solution (Table 2[link]).

Table 2
Crystallization

Method Sitting-drop vapor diffusion
Plate type 96-well Compact 300, Rigaku
Temperature (K) 290
Protein concentration (mg ml−1) 13.46
Buffer composition of protein solution 20 mM HEPES pH 7.0, 300 mM NaCl, 5% glycerol, 1 mM TCEP
Composition of reservoir solution 100 mM Tris pH 5.5, 25%(w/v) PEG 3350, 200 mM ammonium acetate
Volume and ratio of drop 0.4 µl protein solution plus 0.4 µl reservoir solution
Volume of reservoir (µl) 80

2.3. Data collection and processing

Data collection and processing were performed using established protocols at the SSGCID. Specifically, a single crystal was transferred into cryosolution (buffer solution plus 20% ethylene glycol), flash-cooled in liquid nitrogen and transferred into a puck for data collection on APS beamline 21-ID-F. Data were processed using XDS/XSCALE (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]). Additional data-collection information is provided in Table 3[link].

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source SSRL beamline BL12-2
Wavelength (Å) 0.9795
Temperature (K) 100
Detector ADSC Quantum 315R CCD
Space group I4122
a, b, c (Å) 119.90, 119.90, 104.59
α, β, γ (°) 90, 90, 90
Resolution range (Å) 39.41–1.35 (1.42–1.35)
No. of unique reflections 82643 (5692)
Completeness (%) 99.50 (96.60)
Multiplicity 6.30 (4.80)
I/σ(I)〉 13.50
Rr.i.m. 0.081 (5.40)
Overall B factor from Wilson plot (Å2) 14.0
†Estimated Rr.i.m. = Rmerge[N/(N − 1)]1/2, where N is the data multiplicity.

2.4. Structure solution and refinement

The structure was solved by molecular replacement using MOLREP (Lebedev et al., 2008[Lebedev, A. A., Vagin, A. A. & Murshudov, G. N. (2008). Acta Cryst. D64, 33-39.]; Vagin & Teplyakov, 2010[Vagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22-25.]) with the structure of yeast mitochondrial matrix factor 1 (PDB entry 1jd1; Deaconescu et al., 2002[Deaconescu, A. M., Roll-Mecak, A., Bonanno, J. B., Gerchman, S. E., Kycia, H., Studier, F. W. & Burley, S. K. (2002). Proteins, 48, 431-436.]) as the search model. Initial refinement was carried out with REFMAC (Murshudov et al., 2011[Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355-367.]) with TLS, with manual refinement in Coot (Emsley & Cowtan, 2004[Emsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126-2132.]; Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). The structure quality was checked by MolProbity (Headd et al., 2009[Headd, J. J., Immormino, R. M., Keedy, D. A., Emsley, P., Richardson, D. C. & Richardson, J. S. (2009). J. Struct. Funct. Genomics, 10, 83-93.]) and the resulting structure-refinement data are provided in Table 4[link].

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 37.35–1.35 (1.38–1.35)
Completeness (%) 99.6
No. of reflections, working set 82626 (5432)
No. of reflections, test set 4134 (260)
Final Rcryst 0.176 (0.255)
Final Rfree 0.191 (0.264)
Cruickshank DPI 0.056
No. of non-H atoms
 Protein 2971
 Ions 0
 Ligand 20
 Water 443
 Total 3434
R.m.s. deviations
 Bonds (Å) 0.004
 Angles (°) 0.893
Average B factors (Å2)
 Protein 13.5
 Ligands 18.5
 Water 23.7
Ramachandran plot
 Most favored (%) 97.81
 Allowed (%) 2.19
 Outlier (%) 0

3. Results and discussion

Each monomer of the hypothetical G. lamblia protein (GilaA.00312.a; PDB entry 3i3f) folds as a two-layer αβ sandwich. The quaternary structure is a homotrimer stabilized by seven hydrogen bonds and 99 nonbonded contacts per monomer. The trimer forms a β-barrel with core β-sheets surrounded by α-helices (Fig. 2[link]a). The largest interface between the monomers contains electron density for small molecules, which we built as two molecules of pentanoic acid and one of butanoic acid. The ligands have sufficient electron density, as indicated by composite omit maps (Supplementary Fig. S1), and their B factors are consistent with the contacting protein atoms. It is plausible that these ligands have dual conformations or could have been built with other small molecules (Supplementary Figs. S1 and S2). Nonetheless, the significance of these molecules is that they sit in the largest clefts in the structure. These largest clefts have volumes of ∼1850 Å3 and are consistent with the allosteric sites observed in other endoribonucleases.

[Figure 2]
Figure 2
Structure of GilaA.00312.a (PDB entry 3i3f). (a) A GilaA.00312.a trimer with one monomer shown as a white surface; the identical residues in similar proteins are shown in red. (b) Alternative view of the trimer showing the unique insertion found in GilaA.00312.a as gold sticks. Endoribonuclease allosteric sites are identified by the modeled ligands in ball-and-stick representation. (c) Superposition of the GilaA.00312.a monomer (aquamarine) on the closest structures (gray). (d) A GilaA.00312.a trimer (aquamarine) superposed on the closest structures (gray). (e) ENDScript alignment of the closest structures. The secondary-structure elements shown are α-helices (α), 310-helices (η), β-strands (β) and β-turns (TT). Identical residues are shown in red and similar residues in yellow. The same structures are used in (c), (d) and (e).

ENDScript (Gouet et al., 2003[Gouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320-3323.]; Robert & Gouet, 2014[Robert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320-W324.]) analysis was used to identify the most similar structures to GilaA.00312.a (Fig. 2[link]). The most similar structures identified from the analysis were those of YabJ from Bacillus subtilis (PDB entries 5y6u, 1qd9 and 7cd2; Sinha et al., 1999[Sinha, S., Rappu, P., Lange, S. C., Mäntsälä, P., Zalkin, H. & Smith, J. L. (1999). Proc. Natl Acad. Sci. USA, 96, 13074-13079.]; Fujimoto et al., 2021[Fujimoto, Z., Hong, L. T. T., Kishine, N., Suzuki, N. & Kimura, K. (2021). Biosci. Biotechnol. Biochem. 85, 297-306.]). A conserved hypothetical protein from Clostridium thermocellum Cth-2968 (PDB entry 1xrg) was identified as the next closest structure. Other similar structures include Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (PDB entry 1jd1; Deaconescu et al., 2002[Deaconescu, A. M., Roll-Mecak, A., Bonanno, J. B., Gerchman, S. E., Kycia, H., Studier, F. W. & Burley, S. K. (2002). Proteins, 48, 431-436.]), a putative translation-initiation inhibitor PH0854 from Pyrococcus horikoshii (PDB entry 2dyy), a putative endonuclease from Entamoeba histolyca (PDB entry 3mqw), Saccharomyces cerevisiae mitochondrial matrix protein Mmf1 (PDB entry 3quw; Pu et al., 2011[Pu, Y.-G., Jiang, Y.-L., Ye, X.-D., Ma, X.-X., Guo, P.-C., Lian, F.-M., Teng, Y.-B., Chen, Y. & Zhou, C.-Z. (2011). J. Struct. Biol. 175, 469-474.]), TTHA0137 from Thermus thermophilus HB8 (PDB entry 2csl) and RidA from the Antarctic bacterium Psychrobacter sp. (PDB entry 6l8p; Kwon et al., 2020[Kwon, S., Lee, C. W., Koh, H. Y., Park, H., Lee, J. H. & Park, H. H. (2020). Biochem. Biophys. Res. Commun. 522, 585-591.]). The similar structures identified by ENDScript analysis belong to the YjgF/YER057c/UK114 family of endoribonucleases with L-PSP topology (Kim et al., 2018[Kim, H. J., Kwon, A.-R. & Lee, B.-J. (2018). Biosci. Rep. 38, BSR20180768.]; Zhang et al., 2010[Zhang, H.-M., Gao, Y., Li, M. & Chang, W.-R. (2010). Biochem. Biophys. Res. Commun. 397, 82-86.]; Volz, 1999[Volz, K. (1999). Protein Sci. 8, 2428-2437.]). Structural analysis with PDBeFold (https://www.ebi.ac.uk/msd-srv/ssm/; Krissinel & Henrick, 2004[Krissinel, E. & Henrick, K. (2004). Acta Cryst. D60, 2256-2268.]) and the DALI server (https://ekhidna2.biocenter.helsinki.fi/dali/; Holm, 2020[Holm, L. (2020). Protein Sci. 29, 128-140.]) confirms that GilaA.00312.a has the structural features of the YjgF/YER057c/UK114 family of endoribo­nucleases (Figs. 2[link] and 3[link]). Detailed results of the DALI and PDBeFold analysis are included in the supporting information.

[Figure 3]
Figure 3
Structural and primary-sequence alignment of GilaA.00312.a and structurally similar YjgF/YER057c/UK114 endoribonucleases. The secondary-structure elements are shown as follows: α-helices are shown as large coils, 310-helices ae shown as small coils labeled η, β-strands are shown as arrows labeled β and β-turns are labeled TT. Identical residues are shown on a red background; conserved residues are shown in red and conserved regions in blue boxes. This figure was generated using ESPript (Gouet et al., 1999[Gouet, P., Courcelle, E., Stuart, D. I. & Métoz, F. (1999). Bioinformatics, 15, 305-308.], 2003[Gouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320-3323.]).

The YjgF/YER057c/UK114 family of endoribonucleases belong to the superfamily of proteins known as endoribo­nuclease L-PSP/chorismate mutase-like (IPR013813). These are homotrimeric proteins in which the intermolecular cavity forms putative allosteric binding sites for small molecules (Mistiniene et al., 2003[Mistiniene, E., Luksa, V., Sereikaite, J. & Naktinis, V. (2003). Bioconjug. Chem. 14, 1243-1252.]; Burman et al., 2003[Burman, J. D., Stevenson, C. E. M., Hauton, K. A., Sawers, G. & Lawson, D. M. (2003). Acta Cryst. D59, 1076-1078.], 2007[Burman, J. D., Stevenson, C. E. M., Sawers, R. G. & Lawson, D. M. (2007). BMC Struct. Biol. 7, 30.]; Miyakawa et al., 2006[Miyakawa, T., Lee, W. C., Hatano, K., Kato, Y., Sawano, Y., Miyazono, K., Nagata, K. & Tanokura, M. (2006). Proteins, 62, 557-561.]). The superfamily includes two broadly defined families: YjgF/YER057c/UK114 and AroH chorismate mutases. The YjgF/YER057c/UK114 family are found in bacteria, archaea and eukaryotes (Lambrecht et al., 2012[Lambrecht, J. A., Flynn, J. M. & Downs, D. M. (2012). J. Biol. Chem. 287, 3454-3461.]), while AroH chorismate mutases are only found in bacteria. Specific members of the superfamily are YjgF (which was renamed RidA), which is known to deaminate reactive enamine/imine intermediates in pyridoxal 5′-phosphate (PLP)-dependent enzyme reactions (Lambrecht et al., 2012[Lambrecht, J. A., Flynn, J. M. & Downs, D. M. (2012). J. Biol. Chem. 287, 3454-3461.]), and the yeast growth inhibitor YER057c, which has roles in the regulation of metabolic pathways and cell differentiation (Kim et al., 2001[Kim, J.-M., Yoshikawa, H. & Shirahige, K. (2001). Genes Cells, 6, 507-517.]). Other members include UK114/L-PSP (liver perchloric acid-soluble protein), mammalian translational inhibitor proteins and endoribonucleases that directly affect mRNA translation by inducing disaggregation of the reticulo­cyte polysomes into 80S ribosomes (Morishita et al., 1999[Morishita, R., Kawagoshi, A., Sawasaki, T., Madin, K., Ogasawara, T., Oka, T. & Endo, Y. (1999). J. Biol. Chem. 274, 20688-20692.]). RutC is essential for the ability of E. coli to use uracil as a sole nitrogen source and possibly by reducing aminoacrylate peracid to aminoacrylate (Kim et al., 2010[Kim, K.-S., Pelton, J. G., Inwood, W. B., Andersen, U., Kustu, S. & Wemmer, D. E. (2010). J. Bacteriol. 192, 4089-4102.]), while B. subtilis YabJ is required for adenine-mediated repression of purine-biosynthetic genes (Sinha et al., 1999[Sinha, S., Rappu, P., Lange, S. C., Mäntsälä, P., Zalkin, H. & Smith, J. L. (1999). Proc. Natl Acad. Sci. USA, 96, 13074-13079.]). The structural neighbors of GilaA.00312.a are all members of the YjgF/YER057c/UK114 family and the overall structural topology is well conserved (Figs. 2[link] and 3[link]). These closest structures share less than 32.1% sequence with GilaA.00312.a (Fig. 3[link]).

GilaA.00312.a has a unique insertion of three residues (LSD) that differentiates it from its structural neighbors (Fig. 2[link]). These residues follow Ser92 in the loop preceding α-helix 2 and form part of the access to the allosteric binding cavity of GilaA.00312.a (Figs. 2[link] and 3[link]). Furthermore, the allosteric site of GilaA.00312.a differs from the conserved topology of its structural neighbors (Figs. 2[link] and 3[link]). The significance of this observation will be investigated further since experimental evidence indicate that the metabolic functions of endoribo­nucleases are mediated by the allosteric site (Niehaus et al., 2015[Niehaus, T. D., Gerdes, S., Hodge-Hanson, K., Zhukov, A., Cooper, A. J., ElBadawi-Sidhu, M., Fiehn, O., Downs, D. M. & Hanson, A. D. (2015). BMC Genomics, 16, 382.]).

4. Closing remarks

The structure of a hypothetical protein from G. lamblia (GilaA.00312.a) suggests that it belongs to the YjgF/YER057c/UK114 family, forming a trimer with allosteric active sites. Future studies are required to determine the ligands that bind to GilaA.00312.a and the specific mechanisms of its functions in the light of the observed unique structural features in its allosteric binding site.

Supporting information


Footnotes

These Hampton University students should be considered co-first authors; their names are listed alphabetically.

Acknowledgements

We thank the SSGCID cloning and protein-production groups at the Center for Infectious Disease Research and the University of Washington. This research used resources of the Advanced Photon Source, a US Department of Energy (DOE) Office of Science User Facility operated for the DOE Office of Science by Argonne National Laboratory under Contract No. DE-AC02-06CH11357. Use of LS-CAT Sector 21 was supported by the Michigan Economic Development Corporation and the Michigan Technology Tri-Corridor (Grant 085P1000817).

Funding information

This work was supported by National Institutes of Health/National Institute of Allergy and Infectious Diseases (contract Nos. HHSN272201700059C, HHSN272201200025C and HHSN272200700057C to PJM). Hampton University students were part of a Hampton University Chemistry Education and Mentorship Course-based Undergraduate Research pilot (HU-ChEM CURES) funded by the National Institute of General Medical Sciences (award No. 1U01GM138433 to OAA).

References

First citationAslanidis, C. & de Jong, P. J. (1990). Nucleic Acids Res. 18, 6069–6074.  CrossRef CAS PubMed Web of Science Google Scholar
First citationBryan, C. M., Bhandari, J., Napuli, A. J., Leibly, D. J., Choi, R., Kelley, A., Van Voorhis, W. C., Edwards, T. E. & Stewart, L. J. (2011). Acta Cryst. F67, 1010–1014.  Web of Science CrossRef IUCr Journals Google Scholar
First citationBurman, J. D., Stevenson, C. E. M., Hauton, K. A., Sawers, G. & Lawson, D. M. (2003). Acta Cryst. D59, 1076–1078.  CrossRef CAS IUCr Journals Google Scholar
First citationBurman, J. D., Stevenson, C. E. M., Sawers, R. G. & Lawson, D. M. (2007). BMC Struct. Biol. 7, 30.  Google Scholar
First citationChoi, R., Kelley, A., Leibly, D., Nakazawa Hewitt, S., Napuli, A. & Van Voorhis, W. (2011). Acta Cryst. F67, 998–1005.  Web of Science CrossRef IUCr Journals Google Scholar
First citationDaniels, M. E., Shrivastava, A., Smith, W. A., Sahu, P., Odagiri, M., Misra, P. R., Panigrahi, P., Suar, M., Clasen, T. & Jenkins, M. W. (2015). Am. J. Trop. Med. Hyg. 93, 596–600.  CrossRef PubMed Google Scholar
First citationDeaconescu, A. M., Roll-Mecak, A., Bonanno, J. B., Gerchman, S. E., Kycia, H., Studier, F. W. & Burley, S. K. (2002). Proteins, 48, 431–436.  CrossRef PubMed CAS Google Scholar
First citationEmsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126–2132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEscobedo, A. A., Arencibia, R., Vega, R. L., Rodríguez-Morales, A. J., Almirall, P. & Alfonso, M. (2015). J. Infect. Dev. Ctries, 9, 76–86.  CrossRef CAS PubMed Google Scholar
First citationFujimoto, Z., Hong, L. T. T., Kishine, N., Suzuki, N. & Kimura, K. (2021). Biosci. Biotechnol. Biochem. 85, 297–306.  CrossRef PubMed Google Scholar
First citationGouet, P., Courcelle, E., Stuart, D. I. & Métoz, F. (1999). Bioinformatics, 15, 305–308.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320–3323.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHeadd, J. J., Immormino, R. M., Keedy, D. A., Emsley, P., Richardson, D. C. & Richardson, J. S. (2009). J. Struct. Funct. Genomics, 10, 83–93.  CrossRef PubMed CAS Google Scholar
First citationHolm, L. (2020). Protein Sci. 29, 128–140.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHuang, D. B. & White, A. C. (2006). Gastroenterol. Clin. North Am. 35, 291–314.  CrossRef PubMed Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKim, H. J., Kwon, A.-R. & Lee, B.-J. (2018). Biosci. Rep. 38, BSR20180768.  Web of Science CrossRef PubMed Google Scholar
First citationKim, J.-M., Yoshikawa, H. & Shirahige, K. (2001). Genes Cells, 6, 507–517.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKim, K.-S., Pelton, J. G., Inwood, W. B., Andersen, U., Kustu, S. & Wemmer, D. E. (2010). J. Bacteriol. 192, 4089–4102.  Web of Science CrossRef CAS PubMed Google Scholar
First citationKrissinel, E. & Henrick, K. (2004). Acta Cryst. D60, 2256–2268.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKwon, S., Lee, C. W., Koh, H. Y., Park, H., Lee, J. H. & Park, H. H. (2020). Biochem. Biophys. Res. Commun. 522, 585–591.  CrossRef CAS PubMed Google Scholar
First citationLambrecht, J. A., Flynn, J. M. & Downs, D. M. (2012). J. Biol. Chem. 287, 3454–3461.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLebedev, A. A., Vagin, A. A. & Murshudov, G. N. (2008). Acta Cryst. D64, 33–39.  Web of Science CrossRef IUCr Journals Google Scholar
First citationLobovská, A. & Nohýnková, E. (2003). Cas. Lek. Cesk. 142, 177–181.  PubMed Google Scholar
First citationMcIntyre, K. M., Setzkorn, C., Wardeh, M., Hepworth, P. J., Radford, A. D. & Baylis, M. (2014). Prev. Vet. Med. 116, 325–335.  CrossRef CAS PubMed Google Scholar
First citationMistiniene, E., Luksa, V., Sereikaite, J. & Naktinis, V. (2003). Bioconjug. Chem. 14, 1243–1252.  CrossRef PubMed CAS Google Scholar
First citationMiyakawa, T., Lee, W. C., Hatano, K., Kato, Y., Sawano, Y., Miyazono, K., Nagata, K. & Tanokura, M. (2006). Proteins, 62, 557–561.  CrossRef PubMed CAS Google Scholar
First citationMorishita, R., Kawagoshi, A., Sawasaki, T., Madin, K., Ogasawara, T., Oka, T. & Endo, Y. (1999). J. Biol. Chem. 274, 20688–20692.  Web of Science CrossRef PubMed CAS Google Scholar
First citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationNiehaus, T. D., Gerdes, S., Hodge-Hanson, K., Zhukov, A., Cooper, A. J., ElBadawi-Sidhu, M., Fiehn, O., Downs, D. M. & Hanson, A. D. (2015). BMC Genomics, 16, 382.  Google Scholar
First citationPu, Y.-G., Jiang, Y.-L., Ye, X.-D., Ma, X.-X., Guo, P.-C., Lian, F.-M., Teng, Y.-B., Chen, Y. & Zhou, C.-Z. (2011). J. Struct. Biol. 175, 469–474.  CrossRef CAS PubMed Google Scholar
First citationRobert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320–W324.  Web of Science CrossRef CAS PubMed Google Scholar
First citationSerbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594–599.  Web of Science CrossRef IUCr Journals Google Scholar
First citationSinha, S., Rappu, P., Lange, S. C., Mäntsälä, P., Zalkin, H. & Smith, J. L. (1999). Proc. Natl Acad. Sci. USA, 96, 13074–13079.  Web of Science CrossRef PubMed CAS Google Scholar
First citationStudier, F. W. (2005). Protein Expr. Purif. 41, 207–234.  Web of Science CrossRef PubMed CAS Google Scholar
First citationThompson, R. C. (2013). Int. J. Parasitol. 43, 1079–1088.  CrossRef PubMed Google Scholar
First citationVagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22–25.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationVolz, K. (1999). Protein Sci. 8, 2428–2437.  Web of Science CrossRef PubMed CAS Google Scholar
First citationZhang, H.-M., Gao, Y., Li, M. & Chang, W.-R. (2010). Biochem. Biophys. Res. Commun. 397, 82–86.  CrossRef CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds