research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Structures of chloramphenicol acetyltransferase III and Escherichia coli β-keto­acylsynthase III co-crystallized with partially hydrolysed acetyl-oxa(de­thia)CoA

crossmark logo

aPurdue University, 175 South University Street, West Lafayette, IN 47907, USA
*Correspondence e-mail: [email protected]

Edited by M. J. Romao, Universidade Nova de Lisboa, Portugal (Received 25 August 2022; accepted 9 February 2023; online 23 February 2023)

Acetyl coenzyme A (acetyl-CoA) is a reactive metabolite that nonproductively hydrolyzes in a number of enzyme active sites in the crystallization time frame. In order to elucidate the enzyme–acetyl-CoA interactions leading to catalysis, acetyl-CoA substrate analogs are needed. One possible analog for use in structural studies is acetyl-oxa(dethia)CoA (AcOCoA), in which the thioester S atom of CoA is replaced by an O atom. Here, structures of chloramphenicol acetyltransferase III (CATIII) and Escherichia coli ketoacylsynthase III (FabH) from crystals grown in the presence of partially hydrolyzed AcOCoA and the respective nucleophile are presented. Based on the structures, the behavior of AcOCoA differs between the enzymes, with FabH reacting with AcOCoA and CATIII being unreactive. The structure of CATIII reveals insight into the catalytic mechanism, with one active site of the trimer having relatively clear electron density for AcOCoA and chloramphenicol and the other active sites having weaker density for AcOCoA. One FabH structure contains a hydrolyzed AcOCoA product oxa(dethia)CoA (OCoA), while the other FabH structure contains an acyl-enzyme intermediate with OCoA. Together, these structures provide preliminary insight into the use of AcOCoA for enzyme structure–function studies with different nucleophiles.

1. Introduction

Chloramphenicol acetyltransferase III (CATIII) and Escherichia coli ketoacylsynthase III (FabH) both transfer an acetyl group from acetyl-CoA to an acceptor: a hydroxyl and a thiol/thiolate, respectively (Fig. 1[link]). While these enzymes do not share sequence or structural conservation, they both display negative cooperativity in acetyl-CoA substrate binding and catalysis (Ellis et al., 1991[Ellis, J., Bagshaw, C. R. & Shaw, W. V. (1991). Biochemistry, 30, 10806-10813.]; Alhamadsheh et al., 2007[Alhamadsheh, M. M., Musayev, F., Komissarov, A. A., Sachdeva, S., Wright, H. T., Scarsdale, N., Florova, G. & Reynolds, K. A. (2007). Chem. Biol. 14, 513-524.]). The function of negative cooperativity with respect to catalysis is speculative due to a lack of ternary-complex structures. Thus, obtaining structures of these enzymes in complex with substrates would provide insight into the fundamental enzyme–substrate and protein–protein interactions leading to catalysis and cooperativity. The inherent equilibria of the reactions of CATIII and FabH with acetyl-CoA lie so far toward the products that substrate-bound states are difficult to determine. In addition, the inherent reactivity of the acetyl-CoA thioester and nonproductive activation by the enzyme often lead to hydrolysis during crystallization. While there are new methods that may be useful for overcoming the inherent side reactivity of acetyl-CoA during co-crystallization, such as the use of free-electron lasers and serial crystallography, not every system will be amenable as the crystals must survive conformational changes linked to substrate binding (Chapman, 2019[Chapman, H. N. (2019). Annu. Rev. Biochem. 88, 35-58.]). A tried-and-true method is the use of suitable stable substrate or transition-state analogs.

[Figure 1]
Figure 1
The transthiolation step of FabH and the catalytic activity of CATIII.

A substrate analog for both CATIII and FabH is acetyl-oxa(dethia)CoA (AcOCoA), which is expected to be more stable than acetyl-CoA in structure–function studies (Jencks & Gilchrist, 1964[Jencks, W. P. & Gilchrist, M. (1964). J. Am. Chem. Soc. 86, 4651-4654.]; Yang & Drueckhammer, 2001[Yang, W. & Drueckhammer, D. G. (2001). J. Am. Chem. Soc. 123, 11004-11009.]). We recently synthesized AcOCoA and similar analogs to support structure–function studies (Stunkard, Kick et al., 2021[Stunkard, L. M., Kick, B. J. & Lohman, J. R. (2021). Biochemistry, 60, 365-372.]; Stunkard, Benjamin et al., 2021[Stunkard, L. M., Benjamin, A. B., Bower, J. B., Huth, T. J. & Lohman, J. R. (2021). ChemBioChem, 23, e202100487.]; Stunkard et al., 2019[Stunkard, L. M., Dixon, A. D., Huth, T. J. & Lohman, J. R. (2019). J. Am. Chem. Soc. 141, 5121-5124.]). However, the synthesis of AcOCoA has previously been reported (Weeks et al., 2018[Weeks, A. M., Wang, N., Pelton, J. G. & Chang, M. C. Y. (2018). Proc. Natl Acad. Sci. USA, 115, e2193.]). In that study, a similar substrate analog, fluoro­acetyl-oxa(dethia)CoA, was hydrolyzed 500-fold more slowly by a thioesterase than the native fluoroacetyl-CoA substrate. The truncated AcOCoA substrate acetyl-oxa(dethia)pante­theine-pivoyl has been crystallized with a thiolase, where it did not participate in the transthiolation or carbon–carbon bond-forming reactions (Meriläinen et al., 2008[Meriläinen, G., Schmitz, W., Wierenga, R. K. & Kursula, P. (2008). FEBS J. 275, 6136-6148.]). Thus, we initially expected AcOCoA to be relatively stable in CATIII and FabH crystals, both of which crystallize overnight. However, during stability assays we found that FabH was able to hydrolyze AcOCoA to oxa(dethia)CoA (OCoA), albeit extremely slowly compared with acetyl-CoA (Boram et al., 2023[Boram, T. J., Benjamin, A. B., Silva de Sousa, A., Stunkard, L. M., Stewart, T. A., Adams, T. J., Craft, N. A., Velazquez-Marrero, K. G., Ling, J., Nice, J. N. & Lohman, J. R. (2023). ACS Chem. Biol. 18, 49-58.]). While improving the synthesis of AcOCoA, we pursued crystal structures of the model enzymes CATIII and FabH using samples of AcOCoA that contained approximately 25–35% OCoA.

CATIII has long been a model enzyme for structure–function studies with relevance to antibiotic drug development (Shaw & Leslie, 1991[Shaw, W. V. & Leslie, A. G. W. (1991). Annu. Rev. Biophys. Biophys. Chem. 20, 363-386.]). With the recent structure of the ribosome with bound chloramphenicol, there should be renewed interest in finding analogs that retain ribosome inhibition and overcome the activities of CATIII and other chloramphenicol acetyltransferases (Svetlov et al., 2019[Svetlov, M. S., Plessa, E., Chen, C. W., Bougas, A., Krokidis, M. G., Dinos, G. P. & Polikanov, Y. S. (2019). RNA, 25, 600-606.]). Based on the binding of CoA and chloramphenicol, a hypothesis was developed in which the 1-hydroxyl of chloramphenicol stabilizes a water that acts as a member of the oxyanion hole (Lewendon & Shaw, 1993[Lewendon, A. & Shaw, W. V. (1993). J. Biol. Chem. 268, 20997-21001.]; Lewendon et al., 1990[Lewendon, A., Murray, I. A., Shaw, W. V., Gibbs, M. R. & Leslie, A. G. W. (1990). Biochemistry, 29, 2075-2080.]). Thus, some of the catalytic activity and substrate specificity might come from the chloramphenicol substrate itself; in other words, a substrate-assisted catalysis hypothesis. The chloramphenicol analog lacking the 1-hydroxyl is a much poorer substrate, supporting this hypothesis. A ternary structure of AcOCoA and chloramphenicol bound to CATIII could confirm this hypothesis. Furthermore, CATIII is a trimer that displays negative co­operativity with respect to acetyl-CoA. A structure with AcOCoA may reveal conformational differences between the monomers leading to the cooperative behavior. Our structures here reveal a mixture of bound AcOCoA and OCoA, with enough density for AcOCoA to support the substrate-assisted catalysis hypothesis. In addition, each active site of the biologically relevant trimer had varying levels of occupancy. possibly revealing cooperativity.

In Escherichia coli and other similar bacteria, FabH carries out the first acyl carrier protein (ACP)-dependent carbon–carbon bond-forming step, making it a target for antibiotic drug development. The two active sites in the FabH homodimer appear to have negative cooperativity in the binding of and/or reaction with acetyl-CoA (Alhamadsheh et al., 2007[Alhamadsheh, M. M., Musayev, F., Komissarov, A. A., Sachdeva, S., Wright, H. T., Scarsdale, N., Florova, G. & Reynolds, K. A. (2007). Chem. Biol. 14, 513-524.]). Once one FabH active site has formed the acyl-enzyme intermediate, there is a large decrease in the rate of acetyl­ation of the second active site. Comparing crystal structures in the presence and absence of CoA reveals positional variations in loops that interact between the monomers in the dimer, which may explain some of the negative cooperativity. A convoluting factor is that the active-site loops of FabH can be found in a disordered state (PDB entry 1hnk; Qiu et al., 2001[Qiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341-356.]). The disordered state correlates with our recent finding that FabH displays significant hysteresis when presented with malonyl-CoA as a substrate for decarboxylation in the absence of acetyl-CoA (Boram et al., 2023[Boram, T. J., Benjamin, A. B., Silva de Sousa, A., Stunkard, L. M., Stewart, T. A., Adams, T. J., Craft, N. A., Velazquez-Marrero, K. G., Ling, J., Nice, J. N. & Lohman, J. R. (2023). ACS Chem. Biol. 18, 49-58.]). Incubation with acetyl-CoA alleviates the hysteresis, indicating that FabH goes from a disordered state that is not competent for catalysis to a state that is. However, the only structure with an acyl-enzyme intermediate bound has weak density that could be modeled as a partially bound acyl group and an overlapping water (PDB entry 1hnh; electron-density files not deposited; Qiu et al., 2001[Qiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341-356.]). The FabH structures presented here with AcOCoA confirm that the acetyl group is still transferred to generate the acyl-enzyme intermediate. These results reveal that other analogs such as acetyl-aza(dethia)CoA or acetyl-carba(dethia)CoA are needed to capture the acetyl-CoA substrate-bound state of FabH.

The behaviors of CATIII and FabH with AcOCoA provide a comparison of how altering the electrophilic substrate from a thioester to an ester results in very different outcomes with respect to transition-state stabilization. In one case, CATIII, the enzyme is unable to sufficiently stabilize the transition to the product, even on the crystallization time scale of days. With FabH, in contrast, the enzyme is able to generate the thermodynamically unfavorable thioester, albeit with a large excess of substrate, within the same time frame as CATIII. In order to fully comprehend how these enzymes carry out their reactions, it is likely that neutron diffraction will be needed to confirm the positions of H atoms, which are key for catalysis.

2. Materials and methods

2.1. Macromolecule production

Cloning and protein expression were performed as reported previously for FabH (Boram et al., 2023[Boram, T. J., Benjamin, A. B., Silva de Sousa, A., Stunkard, L. M., Stewart, T. A., Adams, T. J., Craft, N. A., Velazquez-Marrero, K. G., Ling, J., Nice, J. N. & Lohman, J. R. (2023). ACS Chem. Biol. 18, 49-58.]). Briefly, fabH from E. coli K-12 genomic DNA (UniProt P0A5R0) was cloned into a pRSF-derived vector with a TEV protease-cleavable site between the protein and the N-terminal hexahistidine (6×His) tag. We found that the addition of two glycines between the TEV site and the FabH N-terminus was necessary for efficient tag cleavage. The CATIII gene was synthesized by Integrated DNA Technologies according to the sequence found in the transmissible plasmid R387 (UniProt P00484) with appropriate overhangs for Gibson cloning into the modified pRSF vector. Again, double glycines were added to facilitate efficient TEV protease cleavage: CATIII+GG. For CATIII+GG, the primers used were (the additional codons yielding the N-terminal sequence SGGNYTK… are underlined) CATIII+GG-forward, 5′-GAGAACCTCTACTTCCAAAGTGGTGGTAACTATACAAAATTTGATG-3′; CATIII+GG-reverse, 5′-CTCGAGGAGATTACGGATTATTTTAATTTACTGTTACAC-3′. Plasmids with fabH+GG and catIII+GG were transformed into E. coli BL21(DE3), which was used as the expression strain. Overnight cultures were used to inoculate LB containing 10 mM MgCl2, trace metals and 50 µg ml−1 kanamycin, which were incubated at 37°C and shaken at 180 rev min−1. Upon reaching an OD600 of ∼0.5–0.6, the temperature was reduced to 18°C. Once the cultures had reached thermal equilibrium, gene expression was induced by the addition of isopropyl β-D-1-thiogalactopyranoside to a final concentration of 500 µg ml−1, with incubation for an additional 16 h. The E. coli cells were harvested by centrifugation at 6300 rev min−1 and 4°C for 30 min.

E. coli cell pellets carrying FabG+GG or CATIII+GG were resuspended in lysis buffer (1 µg ml−1 DNase, 1 µg ml−1 lysozyme, 300 mM NaCl, 20 mM imidazole, 10% glycerol, 20 mM Tris–HCl pH 8.0), sonicated (60 × 1 s on ice) and clarified by centrifugation at 20 000g and 4°C for 30 min. The supernatant was filtered, applied onto a 5 ml HisTrap HP column (GE Healthcare) and washed with lysis buffer using an ÄKTApure fast-performance liquid chromatography system (GE Healthcare). Wash buffer (300 mM NaCl, 40 mM imidazole, 20 mM Tris–HCl pH 8.0) was used to remove additional contaminants, and proteins were eluted with wash buffer containing 500 mM imidazole. At this point, the purity of FabG+GG and CATIII+GG from the fractions was analyzed by sodium dodecyl sulfate–polyacrylamide gel electrophoresis (SDS–PAGE). Pure fractions were pooled and cleaved using TEV protease to remove the 6×His tag. FabG+GG and CATIII+GG were then buffer-exchanged into storage buffer (200 mM NaCl, 10 mM Tris–HCl pH 8.0) followed by the removal of free 6×His tags and 6×His-tagged TEV protease with a 5 ml HisTrap HP column, concentrated and frozen in small aliquots with liquid nitrogen and stored at −80°C. Macromolecule-production information is summarized in Table 1[link].

Table 1
Macromolecule-production information

Protein FabH CATIII
Source organism E. coli K12 Synthetic gene based on plasmid R387
Expression vector pRSF pRSF
Expression host E. coli BL21(DE3) E. coli BL21(DE3)
Complete amino acid-sequence of the construct produced MGSSHHHHHHSGSENLYFQ↓SGGMYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLHADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVRF MGSSHHHHHHSGSENLYFQ↓SGGNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
†↓ indicates the TEV protease cleavage site.

2.2. Crystallization

FabG+GG and CATIII+GG were screened against 384 crystallization conditions in 500 nl sitting drops at 20°C set up with a Mosquito (TTP Labtech, Melbourn, UK) to find initial conditions with AcOCoA (partially hydrolysed). FabH+GG at 21 mg ml−1 with 10 mM AcOCoA produced crystals by the hanging-drop method over 1.0 ml wells containing 1.5% DMSO, 23% PEG 3350, 75 mM MgCl2, 100 mM HEPES–NaOH pH 7.5 or 20% PEG 6000, 3% PEG 400, 100 mM MgCl2. CATIII+GG at 24 mg ml−1 with 10 mM AcOCoA and a saturating concentration of chloramphenicol (solid chloram­phenicol was added to the protein and AcOCoA until powder remained in solution followed by centrifugation to precipitate excess material) produced crystals by the hanging-drop method over 1.0 ml wells containing 46% PEG 400, 100 mM MgCl2, 0.1 M sodium citrate pH 5.5 in 4 µl drops (1:3 protein:well solution ratio). Crystals were looped and cooled directly out of the drops with liquid nitrogen. Crystallization information is summarized in Table 2[link].

Table 2
Crystallization

  Ac-FabH + OCoA FabH + OCoA CATIII + AcOCoA
Method Vapor diffusion, hanging drop Vapor diffusion, hanging drop Vapor diffusion, hanging drop
Plate type VDX VDX VDX
Temperature (K) 298 298 298
Protein concentration (µM) 680 680 960
Buffer composition of protein solution 10 mM AcOCoA, 200 mM NaCl, 10 mM Tris–HCl pH 8.0 10 mM AcOCoA, 200 mM NaCl, 10 mM Tris–HCl pH 8.0 10 mM AcOCoA, saturated chloramphenicol, 200 mM NaCl, 10 mM Tris–HCl pH 8.0
Composition of reservoir solution 75 mM MgCl2, 20% PEG 6000, 3% PEG 400 1.5% DMSO, 75 mM MgCl2, 23% PEG 3350, 100 mM HEPES–NaOH pH 7.5 100 mM MgCl2, 46% PEG 400, 100 mM sodium citrate pH 5.5
Volume and ratio of drop 4 µl; 2:2 protein:well solution 4 µl; 2:2 protein:well solution 4 µl; 1:3 protein:well solution
Volume of reservoir (ml) 1.0 1.0 1.0

2.3. Data collection and processing

X-ray diffraction data for all data sets were collected on LS-CAT beamline 21-ID-G at the Advanced Photon Source at a wavelength of 0.97856 Å. Diffraction intensities were integrated, reduced and scaled using HKL-2000 (Otwinowski & Minor, 1997[Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307-326. ]); data-collection and refinement statistics are listed in Tables 3[link] and 4[link].

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

  Ac-FabH + OCoA FabH + OCoA CATIII + AcOCoA
Diffraction source APS beamline 21-ID-G APS beamline 21-ID-G APS beamline 21-ID-G
Wavelength (Å) 0.97856 0.97856 0.97856
Temperature (K) 80 80 80
Space group P41212 P41212 P42212
a, b, c (Å) 72.63, 72.63, 102.87 72.63, 72.63, 102.87 106.92, 106.92, 126.60
α, β, γ (°) 90, 90, 90 90, 90, 90 90, 90, 90
Resolution range (Å) 50–1.30 (1.35–1.30) 50.0–1.35 (1.40–1.35) 50.0–1.68 (1.74–1.68)
Total No. of reflections 247744 224532 311296
No. of unique reflections 68034 60608 84122
Completeness (%) 99.6 (96.5) 98.7 (100) 99.8 (100)
Multiplicity 14.2 (12.0) 13.9 (13.7) 14.5 (14.3)
I/σ(I)〉 34.4 (1.94) 25.1 (3.85) 23.5 (2.97)
Rr.i.m. 0.070 (0.568) 0.089 (0.797) 0.152 (1.308)
Rp.i.m. 0.019 0.024 0.040
Overall B factor from Wilson plot (Å2) 14.74 20.81 20.37

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

  Ac-FabH + OCoA FabH + OCoA CATIII + AcCoA
Resolution range (Å) 22.99–1.30 (1.35–1.30) 23.59–1.35 (1.38–1.35) 34.33–1.68 (1.72–1.68)
Completeness (%) 99.6 98.7 99.8
No. of reflections, working set 67957 57495 80050
No. of reflections, test set 3446 3041 4005
Final Rcryst 0.144 0.145 0.157
Final Rfree 0.167 0.176 0.201
Cruickshank DPI 0.0458 0.0500 0.0933
No. of non-H atoms
 Protein 2358 2355 5284
 Ion 1 1 2
 Ligand 49 52 230
 Solvent 457 413 809
 Total 2865 2821 6329
R.m.s. deviations
 Bond lengths (Å) 0.015 0.012 0.012
 Angles (°) 2.091 1.909 1.783
Average B factors (Å2)
 Protein 14.1 22.0 21.4
 Ion 32.8 35.5 16.3
 Ligand 22.8 26.1 34.4
 Water 29.7 34.5 32.7
Ramachandran plot
 Most favored (%) 98 97 100
 Allowed (%) 2 3 0

2.4. Structure solution and refinement

Molecular replacement with Phaser was used to solve the structures of FabH with OCoA (PDB entry 6x7r) or acetylated FabH with OCoA (PDB entry 8d1u) based on the coordinates of PDB entry 1hnj (Qiu et al., 2001[Qiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341-356.]); the structure of CATIII with AcOCoA (PDB entry 6x7q) was solved based on the coordinates of PDB entry 3cla (Leslie, 1990[Leslie, A. G. W. (1990). J. Mol. Biol. 213, 167-186.]). Refinement was conducted using REFMAC (Murshudov et al., 2011[Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355-367.]) in the CCP4i package (Winn et al., 2011[Winn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235-242.]) with automated model building performed with ARP/wARP (Langer et al., 2008[Langer, G., Cohen, S. X., Lamzin, V. S. & Perrakis, A. (2008). Nat. Protoc. 3, 1171-1179.]) and manual model building with Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]).

3. Results and discussion

3.1. Structure of CATIII in complex with AcOCoA and chloramphenicol

We co-crystallized CATIII in the presence of partially hydrolyzed AcOCoA and chloramphenicol. This produced crystals that grew overnight in various conditions. The vast majority of crystals gave diffraction patterns that were difficult to index due to what appeared to be twinning problems. Serendipitously, we found a single large crystal that diffracted well, was easily indexed in the primitive tetragonal Bravis lattice and was solved in space group P42212 with a trimer in the asymmetric unit. The final structure had good refinement statistics and all residues for each monomer could be modeled. Although no transition metals were added to the crystallization conditions, we found positions for two metals that we modeled as Zn2+ based on the CheckMyMetal validation server, which would have come from the inclusion of trace metals in the expression medium (Zheng et al., 2017[Zheng, H., Cooper, D. R., Porebski, P. J., Shabalin, I. G., Handing, K. B. & Minor, W. (2017). Acta Cryst. D73, 223-233.]). The metals are liganded by Glu18 and His22 in each chain and the same residues in a symmetry mate trimer, with the following pattern: chain A interacts with symmetry mate chain C and chain B interacts with symmetry mate chain B, creating a larger order hexamer. The previous deposited structures of CATIII belonged to space group R32, with a single molecule per asymmetric unit (we would like to note that the numbering scheme of Leslie and Shaw added five residues to 1–74 and six residues to 75–213; here, we use the linear numbering of CATIII; Leslie, 1990[Leslie, A. G. W. (1990). J. Mol. Biol. 213, 167-186.]; Leslie et al., 1988[Leslie, A. G., Moody, P. C. E. & Shaw, W. V. (1988). Proc. Natl Acad. Sci. USA, 85, 4133-4137.]). The R32 CATIII structures had two Co2+ metal ions bound (0.5 mM Co2+ was added to the crystallization condition): one site is shared with a metal in our structure that forms the hexamer, while the other Co2+ ion occupies a special position situated between the backbone carbonyls of Asn63 and Asp81 with rather long interaction distances of ∼4 Å. While the shared metals generate a larger order hexamer in both crystal forms, all other crystal contacts are essentially unique. Differences in the N-termini of CATIII in previous studies and our study are likely to lead to the variations in crystal packing. The previous R32 structures have an N-terminus starting at Met1 and the N-terminal amine has good packing, with a hydrogen bond to the carbonyl of Lys211 that is likely to stabilize the crystals and is not possible without a free amine. Our construct has an N-terminus with a Ser-Gly-Gly-Asn2 cloning artifact that would disrupt the packing seen in the R32 structures. The R32 crystal packing was reported to deteriorate upon exposure to CoA, preventing elucidation of the binding of acetyl-CoA or analogs via soaking (Leslie et al., 1986[Leslie, A. G. W., Liddell, J. M. & Shaw, W. V. (1986). J. Mol. Biol. 188, 283-285.]). Thus, our structure provides insight into engineering crystal contacts that allow the production of trimers in the asymmetric unit in order to understand the subtle conformational changes associated with negative cooperativity.

Our CATIII structure has clear electron density for chloram­phenicol in each monomer, which resides in exactly the same orientation as in previous structures. The electron density for AcOCoA/OCoA is relatively clear in chain A, somewhat clear in chain B and difficult to model in chain C (Fig. 2[link]). We take the differences in electron density to correspond to negative cooperativity, but differences in crystal packing cannot be ruled out. The AcOCoA in chain A participates in crystal packing and is not free to leave, while the AcOCoA molecules in chains B and C are open to solvent. A comparison of the chains shows slight differences in the loops surrounding the CoA binding pocket in chain C, further supporting the idea of our electron density reflecting negative cooperativity.

[Figure 2]
Figure 2
Electron density for CATIII ligands in the active sites in molecules A (a), B (b) and C (c) in the trimer. AcOCoA or OCoA is shown as black sticks, chloramphenicol is shown as white sticks and CATIII active-site residues are labeled and shown as gray sticks. The water participating in the oxyanion hole and hydrogen-bonded to chloramphenicol is circled in red. The σA-weighted mFoDFc maps for omitted ligands are shown at +3σ in green and −3σ in red as 5 Å bricks. The Ser142 side-chain hydroxyl was also omitted in order to judge occupancy. Note that a water molecule close to the ester O atom in (a) lies in a similar position as a partially occupied water in (c), revealing some presence of OCoA in (a).

In monomer A we can clearly model the position of the acetyl group, even though the electron density supports about 20% OCoA, in which case a water molecule takes the place of the acetyl ketone O atom (Fig. 2[link]). The binding of the acetyl group is almost exactly as predicted by Leslie and Shaw based on a structure with coenzyme A bound (not deposited in the PDB; Fig. 3[link]; Shaw & Leslie, 1991[Shaw, W. V. & Leslie, A. G. W. (1991). Annu. Rev. Biophys. Biophys. Chem. 20, 363-386.]; Leslie et al., 1988[Leslie, A. G., Moody, P. C. E. & Shaw, W. V. (1988). Proc. Natl Acad. Sci. USA, 85, 4133-4137.]). The location of a water bound between the acetyl ketone and the 1-hydroxyl of chloramphenicol suggests that it stabilizes the transition state in concert with His189. This is the first time that a substrate analog of acetyl-CoA has been found in the CATIII active site, revealing that an active-site water interacts with the tetrahedral intermediate, confirming the substrate-assisted catalysis hypothesis. Nevertheless, the positions of the H atoms that are key to catalysis remain to be determined. Our preliminary structures here provide a platform upon which to perform neutron diffraction to obtain a clear idea of how the transition state is set up.

[Figure 3]
Figure 3
Active-site interactions of AcOCoA with CATIII and chloramphenicol co-substrate. Note that a water bound to chloramphenicol helps to create the oxyanion hole, which is circled in red.

3.2. Structures of FabH in complex with OCoA

We co-crystallized FabH in the presence of partially hydrolyzed AcOCoA. This produced crystals that grew overnight in various conditions. The crystals grown from PEG and Mg2+ diffracted well, and were indexed in the primitive tetragonal Bravis lattice and solved in space group P41212 (a = b = 73 Å) with a monomer in the asymmetric unit (Table 1[link]). The final structures had good refinement statistics and all residues for each monomer could be modeled. The previous structures of E. coli FabH fall into one of three crystal forms. Crystal type I (PDB entries 1hnd, 1hnh, 1hnj and 1hnk; Qiu et al., 2001[Qiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341-356.]) is identical to that reported here, while the others are primitive orthorhombic. Crystal type II belongs to space group P212121, with unit-cell parameters a = ∼63, b = ∼65, c = ∼163 Å (PDB entries 1hn9, 3il9, 5bns and 1ebl; Qiu et al., 2001[Qiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341-356.]; McKinney et al., 2016[McKinney, D. C., Eyermann, C. J., Gu, R. F., Hu, J., Kazmirski, S. L., Lahiri, S. D., McKenzie, A. R., Shapiro, A. B. & Breault, G. (2016). ACS Infect. Dis. 2, 456-464.]; Gajiwala et al., 2009[Gajiwala, K. S., Margosiak, S., Lu, J., Cortez, J., Su, Y., Nie, Z. & Appelt, K. (2009). FEBS Lett. 583, 2939-2946.]; Davies et al., 2000[Davies, C., Heath, R. J., White, S. W. & Rock, C. O. (2000). Structure, 8, 185-195.]), and crystal type III belongs to space group P212121, with unit-cell parameters a = ∼64, b = ∼81, c = ∼122 Å (PDB entries 2eft, 2gyo, 5bnm and 4z8d; Alhamadsheh et al., 2007[Alhamadsheh, M. M., Musayev, F., Komissarov, A. A., Sachdeva, S., Wright, H. T., Scarsdale, N., Florova, G. & Reynolds, K. A. (2007). Chem. Biol. 14, 513-524.]; McKinney et al., 2016[McKinney, D. C., Eyermann, C. J., Gu, R. F., Hu, J., Kazmirski, S. L., Lahiri, S. D., McKenzie, A. R., Shapiro, A. B. & Breault, G. (2016). ACS Infect. Dis. 2, 456-464.]), with both having a dimer in the asymmetric unit. Solid density for CoA (PDB entries 1hnd and 1hnj) and partial density for the acyl-enzyme intermediate (PDB 1hnh) have only been seen in crystal type I (Qiu et al., 2001[Qiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341-356.]), with weak CoA density in crystal type II (PDB entry 1ebl; Gajiwala et al., 2009[Gajiwala, K. S., Margosiak, S., Lu, J., Cortez, J., Su, Y., Nie, Z. & Appelt, K. (2009). FEBS Lett. 583, 2939-2946.]) and crystal type III (PDB entries 2eft and 2gyo; Alhamadsheh et al., 2007[Alhamadsheh, M. M., Musayev, F., Komissarov, A. A., Sachdeva, S., Wright, H. T., Scarsdale, N., Florova, G. & Reynolds, K. A. (2007). Chem. Biol. 14, 513-524.]). Based on structural alignments between crystals of type I and types II and III, it appears that an N-terminal His tag may be responsible for favoring type II/III crystals due to clashes that would be present in type I. In our crystals, we observe some disorder in the Ser-Gly-Gly-Met1 tag artifact; however, there is sufficient room that the tag artifact still allows the tight crystal packing found in crystal form I. Elongating the tag may be a way to favor the production of type II/III crystals, which would be helpful for capturing the differences between the active sites associated with negative cooperativity.

Slight differences in the crystallization conditions for our structures resulted in differing amounts of density for the acyl-enzyme intermediate and the OCoA product (Fig. 4[link]). The B factors for the C atoms of the acetyl group of the acyl-enzyme intermediate are ∼1.5–2 times as large as those for the atoms of the cysteine to which they are attached, suggesting maybe 50% occupancy. Our structure with electron density for the acyl-enzyme intermediate has relatively poor electron density for the bound OCoA. Our structure with excellent density for OCoA has no density for the acyl-enzyme intermediate. Taken together, we can obtain a clear view of how the enzyme interacts with the products of AcOCoA. The acyl-enzyme intermediate is very similar in structure to that previously determined with acetyl-CoA (PDB entry 1hnh; Qiu et al., 2001[Qiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341-356.]). Similarly, our structure with clear OCoA bound is almost identical to that with CoA bound (PDB entries 1hnd and 1hnj).

[Figure 4]
Figure 4
Electron density for FabH ligands. OCoA is shown as black sticks and labeled FabH active-site residues as white sticks. The σA-weighted mFoDFc maps are shown at +3σ in green and −3σ in red as 5 Å bricks for (a) omitted OCoA, Cys112 Cβ and sulfur or (b) Cys112 Cβ, sulfur and acetyl group. (a) is Ac-FabH + OCoA and (b) is FabH + OCoA. Note that a water molecule takes the place of the acetyl-cysteine carbonyl.

Unfortunately, due to the presence of only a monomer in our asymmetric unit, it is difficult to gain insight into the negative cooperativity displayed by the enzyme. Nevertheless, careful inspection of the electron-density maps and comparisons with other structures reveals conformational heterogeneity that might help to explain some of the cooperative behavior. The α-helix between Leu249 and Leu258 has spurious density, suggesting that the helix is in an alternate conformation part of the time. Alignment of our FabH structures with the FabH structures in PDB entries 3il9 (Gajiwala et al., 2009[Gajiwala, K. S., Margosiak, S., Lu, J., Cortez, J., Su, Y., Nie, Z. & Appelt, K. (2009). FEBS Lett. 583, 2939-2946.]) and 1ebl (Davies et al., 2000[Davies, C., Heath, R. J., White, S. W. & Rock, C. O. (2000). Structure, 8, 185-195.]) reveals the secondary conformation of this loop, likely reflecting a state without CoA bound (Fig. 5[link]). Questions remain concerning the transthiolation reaction: is the active-site cysteine in the thiol or thiolate state, and how does the protonation state of His244 change before and after the formation of the acyl-enzyme intermediate? The multiple water and nearby side-chain conformations suggest that we do not have the data to accurately interpret how the acyl-enzyme intermediate alters these protonation states. We expect that substrate analogs such as acetyl-aza(dethia)CoA or acetyl-carba(dethia)CoA are needed to capture a `substrate-bound' state of FabH and to overcome the conformational heterogeneity found in these FabH structures.

[Figure 5]
Figure 5
Our FabH structure has alternative conformations for residues 249–258 at low occupancy. Our refined Ac-FabH + OCoA model is shown as white sticks with every other residue labeled, while the residues of FabH in PDB entry 1ebl chain A are shown in black. The Ac-FabH + OCoA σA-weighted 2mFo − DFc map is shown in blue and mFoDFc maps are shown at +3σ in green and −3σ in red. Note how the residues for FabH in PDB entry 1ebl occupy the residual green positive density in our maps, suggesting that some fraction of the alternative conformation is populated in our crystals.

3.3. Different behaviors of AcOCoA in CATIII/FabH active sites

CATIII does not perform the forward reaction between AcOCoA and chloramphenicol during the crystallization time frame at pH 5.5. ΔG for the reaction is expected to be 0, which should give us an equal amount of substrate and product. In our case we used a large excess of chloramphenicol, which should have driven the reaction forward, leaving only OCoA. There are a couple of explanations for the lack of acyl-transfer in this context. (i) The ΔG is inherently too large for trans­esterification to be efficiently overcome by the enzyme due to geometric or electronic properties of the ester compared with the thioester. (ii) The crystallographic pH is far enough below the pKa of the active-site histidine (6.3) to inhibit the reaction (Shaw & Leslie, 1991[Shaw, W. V. & Leslie, A. G. W. (1991). Annu. Rev. Biophys. Biophys. Chem. 20, 363-386.]). We expect that follow-up studies examining the reaction at various pH values may shed light on which of these two hypotheses is correct.

FabH does hydrolyze AcOCoA very slowly under the relatively dilute conditions used in enzymology experiments compared with the crystallographic conditions used here, where AcOCoA is only in an approximately tenfold excess; as such, the rate of FabH hydrolysis is a concern (Boram et al., 2023[Boram, T. J., Benjamin, A. B., Silva de Sousa, A., Stunkard, L. M., Stewart, T. A., Adams, T. J., Craft, N. A., Velazquez-Marrero, K. G., Ling, J., Nice, J. N. & Lohman, J. R. (2023). ACS Chem. Biol. 18, 49-58.]). Our structural studies here confirm that hydrolysis can occur through the acyl-enzyme intermediate. The formation of the acyl-enzyme intermediate is somewhat unexpected, as it is unfavorable with a positive ΔG. We used approximately tenfold more AcOCoA than FabH in our crystallization conditions, which may have contributed to the spontaneous formation of the acyl-enzyme intermediate. We observed a similar rate of hydrolysis for AcOCoA and acetyl-CoA in the absence of a malonyl-thioester substrate at pH 8, which is ten times higher than background hydrolysis in buffer, suggesting that FabH does have a noticeable effect (Boram et al., 2023[Boram, T. J., Benjamin, A. B., Silva de Sousa, A., Stunkard, L. M., Stewart, T. A., Adams, T. J., Craft, N. A., Velazquez-Marrero, K. G., Ling, J., Nice, J. N. & Lohman, J. R. (2023). ACS Chem. Biol. 18, 49-58.]). However, it did not appear that AcOCoA acts as an acyl donor, since the reaction in the presence of malonyl-CoA did not yield more product than malonyl-CoA alone. Similar to CATIII, it appears that it is geometric or electronic considerations that become rate-limiting in the reaction of FabH with AcOCoA. Future studies examining substrate binding of acetyl-CoA will require a different strategy to using AcOCoA, such as more stable analogs.

Our structures demonstrate different behaviors of AcOCoA depending on the context. AcOCoA is a substrate analog for CATIII but a very slow substrate for FabH. It may be the case that hydroxyl acceptors in general will lead to substrate-analog behavior and thiol acceptors will lead to product formation. With the aforementioned fluoroacetyl-CoA hydrolase, which generates a threonine-based acyl-enzyme intermediate, fluoroacetyl-oxy(dethia)CoA was a substrate with a 500-fold slower rate (Dias et al., 2010[Dias, M. V., Huang, F., Chirgadze, D. Y., Tosin, M., Spiteller, D., Dry, E. F., Leadlay, P. F., Spencer, J. B. & Blundell, T. L. (2010). J. Biol. Chem. 285, 22495-22504.]; Weeks et al., 2010[Weeks, A. M., Coyle, S. M., Jinek, M., Doudna, J. A. & Chang, M. C. Y. (2010). Biochemistry, 49, 9269-9279.], 2018[Weeks, A. M., Wang, N., Pelton, J. G. & Chang, M. C. Y. (2018). Proc. Natl Acad. Sci. USA, 115, e2193.]). Together, this suggests that acyl-oxy(dethia)CoAs are likely to be useful tools for studying many enzymes with hydroxyl nucleophiles. The catalytic interactions of many Gcn5-related N-acetyltransferases (GNATs) still remain uncharacterized due to the spontaneous hydrolysis of acetyl-CoA and reactivity with their substrates. Our studies here with CATIII suggest that acyl-oxy(dethia)CoAs might be effective in capturing the ternary complexes; however, their reactivity with amine nucleophiles remains to be examined.

Funding information

This work was supported in part by NIH grant GM140290.

References

First citationAlhamadsheh, M. M., Musayev, F., Komissarov, A. A., Sachdeva, S., Wright, H. T., Scarsdale, N., Florova, G. & Reynolds, K. A. (2007). Chem. Biol. 14, 513–524.  CrossRef PubMed CAS Google Scholar
First citationBoram, T. J., Benjamin, A. B., Silva de Sousa, A., Stunkard, L. M., Stewart, T. A., Adams, T. J., Craft, N. A., Velazquez-Marrero, K. G., Ling, J., Nice, J. N. & Lohman, J. R. (2023). ACS Chem. Biol. 18, 49–58.  CrossRef CAS PubMed Google Scholar
First citationChapman, H. N. (2019). Annu. Rev. Biochem. 88, 35–58.  Web of Science CrossRef CAS PubMed Google Scholar
First citationDavies, C., Heath, R. J., White, S. W. & Rock, C. O. (2000). Structure, 8, 185–195.  Web of Science CrossRef PubMed CAS Google Scholar
First citationDias, M. V., Huang, F., Chirgadze, D. Y., Tosin, M., Spiteller, D., Dry, E. F., Leadlay, P. F., Spencer, J. B. & Blundell, T. L. (2010). J. Biol. Chem. 285, 22495–22504.  Web of Science CrossRef CAS PubMed Google Scholar
First citationEllis, J., Bagshaw, C. R. & Shaw, W. V. (1991). Biochemistry, 30, 10806–10813.  CrossRef PubMed CAS Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationGajiwala, K. S., Margosiak, S., Lu, J., Cortez, J., Su, Y., Nie, Z. & Appelt, K. (2009). FEBS Lett. 583, 2939–2946.  Web of Science CrossRef PubMed CAS Google Scholar
First citationJencks, W. P. & Gilchrist, M. (1964). J. Am. Chem. Soc. 86, 4651–4654.  CrossRef CAS Google Scholar
First citationLanger, G., Cohen, S. X., Lamzin, V. S. & Perrakis, A. (2008). Nat. Protoc. 3, 1171–1179.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLeslie, A. G., Moody, P. C. E. & Shaw, W. V. (1988). Proc. Natl Acad. Sci. USA, 85, 4133–4137.  CrossRef CAS PubMed Google Scholar
First citationLeslie, A. G. W. (1990). J. Mol. Biol. 213, 167–186.  CrossRef CAS PubMed Web of Science Google Scholar
First citationLeslie, A. G. W., Liddell, J. M. & Shaw, W. V. (1986). J. Mol. Biol. 188, 283–285.  CrossRef CAS PubMed Google Scholar
First citationLewendon, A., Murray, I. A., Shaw, W. V., Gibbs, M. R. & Leslie, A. G. W. (1990). Biochemistry, 29, 2075–2080.  CrossRef CAS PubMed Google Scholar
First citationLewendon, A. & Shaw, W. V. (1993). J. Biol. Chem. 268, 20997–21001.  CrossRef CAS PubMed Google Scholar
First citationMcKinney, D. C., Eyermann, C. J., Gu, R. F., Hu, J., Kazmirski, S. L., Lahiri, S. D., McKenzie, A. R., Shapiro, A. B. & Breault, G. (2016). ACS Infect. Dis. 2, 456–464.  CrossRef CAS PubMed Google Scholar
First citationMeriläinen, G., Schmitz, W., Wierenga, R. K. & Kursula, P. (2008). FEBS J. 275, 6136–6148.  PubMed Google Scholar
First citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationOtwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326.   CrossRef CAS PubMed Web of Science Google Scholar
First citationQiu, X., Janson, C. A., Smith, W. W., Head, M., Lonsdale, J. & Konstantinidis, A. K. (2001). J. Mol. Biol. 307, 341–356.  Web of Science CrossRef PubMed CAS Google Scholar
First citationShaw, W. V. & Leslie, A. G. W. (1991). Annu. Rev. Biophys. Biophys. Chem. 20, 363–386.  CrossRef PubMed CAS Web of Science Google Scholar
First citationStunkard, L. M., Benjamin, A. B., Bower, J. B., Huth, T. J. & Lohman, J. R. (2021). ChemBioChem, 23, e202100487.  PubMed Google Scholar
First citationStunkard, L. M., Dixon, A. D., Huth, T. J. & Lohman, J. R. (2019). J. Am. Chem. Soc. 141, 5121–5124.  CrossRef CAS PubMed Google Scholar
First citationStunkard, L. M., Kick, B. J. & Lohman, J. R. (2021). Biochemistry, 60, 365–372.  CrossRef CAS PubMed Google Scholar
First citationSvetlov, M. S., Plessa, E., Chen, C. W., Bougas, A., Krokidis, M. G., Dinos, G. P. & Polikanov, Y. S. (2019). RNA, 25, 600–606.  CrossRef CAS PubMed Google Scholar
First citationWeeks, A. M., Coyle, S. M., Jinek, M., Doudna, J. A. & Chang, M. C. Y. (2010). Biochemistry, 49, 9269–9279.  CrossRef CAS PubMed Google Scholar
First citationWeeks, A. M., Wang, N., Pelton, J. G. & Chang, M. C. Y. (2018). Proc. Natl Acad. Sci. USA, 115, e2193.  CrossRef PubMed Google Scholar
First citationWinn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationYang, W. & Drueckhammer, D. G. (2001). J. Am. Chem. Soc. 123, 11004–11009.  Web of Science CrossRef PubMed CAS Google Scholar
First citationZheng, H., Cooper, D. R., Porebski, P. J., Shabalin, I. G., Handing, K. B. & Minor, W. (2017). Acta Cryst. D73, 223–233.  Web of Science CrossRef IUCr Journals Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds