research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Crystal structure of N-acetylmannosamine kinase from Fusobacterium nucleatum

CROSSMARK_Color_square_no_text.svg

aDepartment of Chemistry and Molecular Biology, University of Gothenburg, Box 462, 40530 Gothenburg, Sweden, bCentre for Antibiotic Resistance Research (CARe), University of Gothenburg, Box 440, 40530 Gothenburg, Sweden, cAtomic Physics, Department of Physics, Lund University, Professorsgatan 1, 22363 Lund, Sweden, dInstitute for Stem Cell Biology and Regenerative Medicine, GKVK Post, Bangalore 560 065, India, eSchool of Life Sciences, TransDisciplinary University, Bangalore 560 064, India, fBiomolecular Interaction Centre and School of Biological Sciences, University of Canterbury, Private Bag 4800, Christchurch 8041, New Zealand, and gDepartment of Structural Biology, Stanford University School of Medicine, 299 Campus Drive West, Stanford, CA 94305-5126, USA
*Correspondence e-mail: [email protected], [email protected]

Edited by L. J. Beamer, University of Missouri, USA (Received 5 April 2017; accepted 19 May 2017; online 31 May 2017)

Sialic acids comprise a varied group of nine-carbon amino sugars that are widely distributed among mammals and higher metazoans. Some human commensals and bacterial pathogens can scavenge sialic acids from their environment and degrade them for use as a carbon and nitrogen source. The enzyme N-acetylmannosamine kinase (NanK; EC 2.7.1.60) belongs to the transcriptional repressors, uncharacterized open reading frames and sugar kinases (ROK) superfamily. NanK catalyzes the second step of the sialic acid catabolic pathway, transferring a phosphate group from adenosine 5′-triphos­phate to the C6 position of N-acetylmannosamine to generate N-acetylmannosamine 6-phosphate. The structure of NanK from Fusobacterium nucleatum was determined to 2.23 Å resolution by X-ray crystallography. Unlike other NanK enzymes and ROK family members, F. nucleatum NanK does not have a conserved zinc-binding site. In spite of the absence of the zinc-binding site, all of the major structural features of enzymatic activity are conserved.

1. Introduction

Sialic acids comprise a large family of acidic sugars that contain a core nine-carbon backbone (Angata & Varki, 2002[Angata, T. & Varki, A. (2002). Chem. Rev. 102, 439-469.]; Vimr et al., 2004[Vimr, E. R., Kalivoda, K. A., Deszo, E. L. & Steenbergen, S. M. (2004). Microbiol. Mol. Biol. Rev. 68, 132-153.]; Varki, 1992[Varki, A. (1992). Glycobiology, 2, 25-40.]). The most prevalent type of sialic acid is N-acetylneuraminic acid (Neu5Ac), which is found at the terminal positions of glycoconjugates in humans and other deuterostomes. Sialylation of cell surfaces is crucial for cell–cell interactions and for a range of biological functions that involve cell-signalling processes and modulation of the immune response (Tanner, 2005[Tanner, M. E. (2005). Bioorg. Chem. 33, 216-228.]; Varki, 2007[Varki, A. (2007). Nature (London), 446, 1023-1029.]; Vimr et al., 2004[Vimr, E. R., Kalivoda, K. A., Deszo, E. L. & Steenbergen, S. M. (2004). Microbiol. Mol. Biol. Rev. 68, 132-153.]; Kazatchkine et al., 1979[Kazatchkine, M. D., Fearon, D. T. & Austen, K. F. (1979). J. Immunol. 122, 75-81.]; Lanoue et al., 2002[Lanoue, A., Batista, F. D., Stewart, M. & Neuberger, M. S. (2002). Eur. J. Immunol. 32, 348-355.]). Prompted by evolution to adapt to the sialic acid-rich milieu, many bacteria have developed mechanisms to competitively secure their niche on mucosal surfaces (Almagro-Moreno & Boyd, 2009b[Almagro-Moreno, S. & Boyd, E. F. (2009b). Infect. Immun. 77, 3807-3816.]). Bacteria acquire sialic acids either by cleaving them from the host's glycoconjugates or by scavenging (Vimr, 2013[Vimr, E. R. (2013). ISRN Microbiol. 2013, 816713.]). Once the sialic acid has been transported into the cytosol by specific transporters, some bacteria can incorporate it as a non­reducing terminal sugar on their cell surface for molecular mimicry, and thereby evade the host's innate and adaptive immune response, or can degrade it for use as a carbon and nitrogen source (Mulligan et al., 2011[Mulligan, C., Fischer, M. & Thomas, G. H. (2011). FEMS Microbiol. Rev. 35, 68-86.]). The ability to utilize sialic acid as an energy source is chiefly exploited by commensal and pathogenic bacteria and requires a cluster of genes, known as the nannag cluster (Almagro-Moreno & Boyd, 2009b[Almagro-Moreno, S. & Boyd, E. F. (2009b). Infect. Immun. 77, 3807-3816.], 2010[Almagro-Moreno, S. & Boyd, E. F. (2010). Gut Microbes, 1, 45-50.]; Haines-Menges et al., 2015[Haines-Menges, B. L., Whitaker, W. B., Lubin, J. B. & Boyd, E. F. (2015). Microbiol. Spectr. 3, 321-342.]; Fig. 1[link]). The sialic acid nannag gene cluster was identified in the genome of a Fusobacterium species which exists as a commensal in the gastrointestinal tract and as a periodontal pathogen (Almagro-Moreno & Boyd, 2009a[Almagro-Moreno, S. & Boyd, E. F. (2009a). BMC Evol. Biol. 9, 118.]). Once host sialic acid has been transported across the cytoplasmic membrane (by a two-component sialic acid tripartite ATP-independent periplasmic transport system in F. nucleatum), degradation of Neu5Ac to fructose 6-phosphate starts with the conversion of sialic acid by an N-acetylneuraminate lyase (NanA), yielding N-acetyl­mannosamine (ManNAc) and pyruvate. A phosphoryl group from ATP is then transferred to ManNAc by a kinase (NanK), producing N-acetyl­mannosamine 6-phosphate (ManNAc-6-P), which in turn is converted to N-acetyl­glucosamine 6-phosphate (GlcNAc-6-P) by N-acetyl­mannosamine-6-phosphate 2-epi­merase. Finally, GlcNAC-6-P is deacylated by N-acetyl­glucosamine-6-phosphate deacetylase (NagA) and is subsequently deaminated by glucosamine-6-phosphate deaminase (NagB) to yield fructose 6-phosphate (Vimr & Troy, 1985[Vimr, E. R. & Troy, F. A. (1985). J. Bacteriol. 164, 854-860.]).

[Figure 1]
Figure 1
(a) Sialic acid catabolism in F. nucleatum. SiaT, transporter; NanA, lyase; NanK, kinase; NanE, epimerase; NagA, deacetylase; NagB, deaminase. (b) The chemical reaction catalyzed by N-acetylmannosamine kinase.

F. nucleatum N-acetylmannosamine kinase (FnNanK) belongs to the repressor, open reading frame, kinase (ROK) superfamily of proteins. This collection of polypeptides is primarily composed of transcriptional repressors, sugar kinases and other unknown gene clusters (Titgemeyer et al., 1994[Titgemeyer, F., Reizer, J., Reizer, A. & Saier, M. H. Jr (1994). Microbiology, 140, 2349-2354.]). The salient unifying features of the ROK scaffold are a nucleotide-binding region in the N-terminal region, a strictly conserved catalytic aspartate residue that serves as a Schiff base during phosphoryl transfer and a zinc-binding motif that is implicated in the stability of the active site of the enzyme (Martinez et al., 2012[Martinez, J., Nguyen, L. D., Hinderlich, S., Zimmer, R., Tauberger, E., Reutter, W., Saenger, W., Fan, H. & Moniot, S. (2012). J. Biol. Chem. 287, 13656-13665.]; Conejo et al., 2010[Conejo, M. S., Thompson, S. M. & Miller, B. G. (2010). J. Mol. Evol. 70, 545-556.]). Structural representatives of human N-acetylmannosamine kinase (hMNK) domain of UDP-N-acetylglucosamine-2-epimerase/N-acetyl­mannosamine kinase (Tong et al., 2009[Tong, Y., Tempel, W., Nedyalkova, L., Mackenzie, F. & Park, H.-W. (2009). PLoS One, 4, e7165.]; Martinez et al., 2012[Martinez, J., Nguyen, L. D., Hinderlich, S., Zimmer, R., Tauberger, E., Reutter, W., Saenger, W., Fan, H. & Moniot, S. (2012). J. Biol. Chem. 287, 13656-13665.]) and two putative NanKs from Escherichia coli (EcNanK; PDB entry 2aa4; New York SGX Research Center for Structural Genomics, unpublished work) and Listeria monocytogenes (LmNanK; PDB entry 4htl; Midwest Center for Structural Genomics, unpublished work) have been deposited in the Protein Data Bank. The overall fold is a butterfly-shaped homodimer. Each monomer consists of two domains that are connected by two hinge loops, allowing the kinase to change from an open conformation to a closed conformation upon substrate binding.

Here, we present the structural analysis of N-acetyl­mannosamine kinase from F. nucleatum. This structure is important for inhibitor design, which may lead to the development of antimicrobial agents for the treatment of periodontal disease.

2. Materials and methods

2.1. F. nucleatum NanK production

The gene encoding F. nucleatum NanK was synthetically generated (GeneArt) and cloned into a pET300 NT/DEST expression vector containing an N-terminal His tag. The recombinant protein was expressed in E. coli BL21(DE3) cells (Novagen). The cells were grown at 37°C in Luria broth (LB) medium supplemented with 100 µg ml−1 ampicillin until they reached mid-log phase (OD600 = ∼0.5–0.7). The cells were induced with 0.2 mM isopropyl β-D-1-thiogalactopyranoside (IPTG) and were grown at 20°C for a further 18 h. The cells were harvested by centrifugation at 5000g for 30 min and were resuspended in buffer A [20 mM Tris–HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 5%(v/v) glycerol].

The cells were disrupted using an EmulsiFlex-C3 (Avestin) at 124 MPa for two cycles. The cell debris was removed by centrifugation at 107 000g for 30 min at 4°C. Macromolecule-production information is summarized in Table 1[link].

Table 1
F. nucleatum NanK production information

Source organism F. nucleatum
DNA source Synthetic gene
Forward primer CAAAAAAGCAGGCTTCATGAATATTTTAGCAATAGAT
Reverse primer CAAGAAAGCTGGGTTTTATCTTTTATTAATTTTCTCT
Cloning vector pMK vector
Expression vector Gateway vector pET300 NT/DEST containing a sequence encoding an N-­terminal His6 tag
Expression host E. coli BL21(DE3)
Complete amino-acid sequence of the construct produced MHHHHHHITSLYKKAGFMNILAIDIGGTMIKYGLVSFDGKILSTDKIKTEASKGLNNILNKID-NIFKRYKENNPVGIAVSGTGQINGMIGKVIGGNPIIPNWIGTNLVKILEEKYNLPIVLENDVNCVALGEKWVGAGKDLSNFICLTIGTGIGGGILLNNQLFRGENFVAGEFGHILIKKGEFEQFASTTALIRLVKERTGKTLNGKEIFDLEKKEILEYQEIISEWIENLTDGLSSIIYCFNPANIILGGGVIEQGEPLINRIKNSLFKKIGPQFKEKLNITQAKLGNNAGMIGASYLLLEKINKR

2.2. Protein purification

FnNanK was purified by affinity chromatography at 4°C using a 5 ml HisTrap FF column (GE Healthcare) pre-equilibrated with buffer A. The bound protein was washed with buffer A and the protein was then eluted with buffer B [20 mM Tris–HCl pH 8.0, 300 mM NaCl, 500 mM imidazole, 5%(v/v) glycerol]. As a final polishing step, the protein was loaded onto a HiLoad 16/600 Superdex 200 size-exclusion column (GE Healthcare) pre-equilibrated with buffer C [20 mM Tris–HCl pH 8.0, 300 mM NaCl, 5%(v/v) glycerol, 1 mM DTT]. The purity of the eluted protein samples was evaluated using SDS–PAGE. The pure samples corresponding to FnNanK were pooled together and concentrated using Vivaspin concentrators to a final concentration of 14 mg ml−1. The protein concentration was determined using an ND-1000 spectrophotometer at 280 nm, using an extinction coefficient of 27 005 M−1 cm−1 and a molecular weight of 33.9 kDa.

2.3. Crystallization

The initial screening for crystallization conditions for F. nucleatum NanK was performed at 293 K using a Mosquito nanolitre-dispensing robot (TTP Labtech) with Crystal Screen HT (Hampton Research). The sitting-drop vapour-diffusion method was used, mixing 0.2 µl protein solution (14 mg ml−1) and 0.2 µl reservoir solution. Within one week, rod-shaped crystals of FnNanK were obtained using a reservoir solution consisting of 0.2 M lithium sulfate monohydrate, 0.1 M Tris–HCl pH 8.5, 30%(w/v) PEG 4000. The crystals were flash-cooled in liquid nitrogen prior to the diffraction experiment. Crystallization conditions are summarized in Table 2[link].

Table 2
Crystallization of F. nucleatum NanK

Method Vapour diffusion, sitting drop
Plate type 96-well Swissci plates
Temperature (K) 293
Protein concentration (mg ml−1) 14
Buffer composition of protein solution 20 mM Tris–HCl pH 8.0, 300 mM NaCl, 5% glycerol, 1 mM DTT
Composition of reservoir solution 0.2 M lithium sulfate monohydrate, 0.1 M Tris–HCl pH 8.5, 30%(w/v) PEG 4000
Volume of drop (nl) 200
Volume of reservoir (µl) 80

2.4. Data collection and processing

The crystals of FnNanK diffracted to 2.23 Å resolution. X-ray diffraction data were collected at 100 K on the I911-3 beamline at the MAX-lab National Research Laboratory for Nuclear Physics and Synchrotron Radiation Research, Lund, Sweden using X-rays at a wavelength of 1.0 Å. Diffraction intensities were processed and integrated using iMosflm (Battye et al., 2011[Battye, T. G. G., Kontogiannis, L., Johnson, O., Powell, H. R. & Leslie, A. G. W. (2011). Acta Cryst. D67, 271-281.]) and were scaled using AIMLESS from the CCP4 program suite (Evans & Murshudov, 2013[Evans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204-1214.]). Data-collection and processing statistics are shown in Table 3[link].

Table 3
Data collection and processing for F. nucleatum NanK

Values in parentheses are for the outer shell.

Diffraction source MAX-lab synchrotron
Wavelength (Å) 1.0
Temperature (K) 100
Detector MAR CCD
Crystal-to-detector distance (mm) 210.69
Rotation range per image (°) 0.50
Total rotation range (°) 125.50
Exposure time per image (s) 30
Space group P3221
a, b, c (Å) 126.5, 126.5, 108.8
α, β, γ (°) 90, 90, 120
Mosaicity (°) 0.55
Resolution range (Å) 48.94–2.23 (2.31–2.23)
Total No. of observations 5433 (31890)
No. of unique reflections 49344 (4891)
Completeness (%) 100 (100)
CC1/2 0.99 (0.59)
Multiplicity 6.4 (7.1)
I/σ(I)〉 11.7 (1.64)
Rp.i.m. 0.019 (0.399)
Overall B factor from Wilson plot (Å2) 29.4

2.5. Structure solution and refinement

The structure of F. nucleatum NanK was determined by molecular replacement using the coordinates of L. monocytogenes NanK (PDB entry 4htl) as a search model using Phaser (Read, 2001[Read, R. J. (2001). Acta Cryst. D57, 1373-1382.]) within the PHENIX software suite (Adams et al., 1999[Adams, P. D., Pannu, N. S., Read, R. J. & Brunger, A. T. (1999). Acta Cryst. D55, 181-190.], 2011[Adams, P. D. et al. (2011). Methods, 55, 94-106.]). The phenix.autobuild program was used for initial model building and electron-density improvement. Subsequently, phenix.refine was used for rigid-body refinement, maximum-likelihood least-squares refinement, simulated annealing and addition of water molecules to the structure. Manual inspection and model building were performed using Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). Structure-solution and refinement statistics are summarized in Table 4[link].

Table 4
Structure solution and refinement for F. nucleatum NanK

Values in parentheses are for the outer shell.

Resolution range (Å) 48.94–2.23 (2.31–2.23)
Completeness (%) 100
σ Cutoff  
No. of reflections, working set 49333 (4893)
No. of reflections, test set 2384 (210)
Final Rcryst (%) 17.7
Final Rfree (%) 22.1
No. of non-H atoms
 Protein 4486
 Water 479
 Total 4965
R.m.s. deviations from ideal geometry
 Bonds (Å) 0.010
 Angles (°) 1.09
Average B factors (Å2)
 Protein 36.00
 Water 42.10
Ramachandran plot
 Most favoured (%) 98
 Allowed (%) 2.4

3. Results and discussion

3.1. Protein production, purification and crystallization

F. nucleatum NanK (FnNanK) was successfully expressed and purified using a two-step procedure consisting of affinity and size-exclusion chromatography and was concentrated to a final concentration of 14 mg ml−1. The preparations were homogenous when analyzed by SDS–PAGE and size-exclusion chromatography. Using the sitting-drop vapour-diffusion method, rod-shaped crystals formed within one week using a reservoir solution consisting of 0.2 M lithium sulfate monohydrate, 0.1 M Tris–HCl pH 8.5, 30%(w/v) PEG 4000.

3.2. Crystal structure of F. nucleatum NanK

The structure of FnNanK has one homodimer in the asymmetric unit, corresponding to a solvent content of 38%. The structure was refined to 2.23 Å resolution with an Rcryst of 17.7% and an Rfree of 22% (Tables 3[link] and 4[link]). No electron density could be attributed to the residues of the N-terminal tag, which are consequently missing from the final model. The structure has no Ramachandran outliers, with 98% and 2% of the residues in the preferred and allowed regions, respectively.

3.2.1. Overall structure

FnNanK is a butterfly-shaped homodimer, as seen in other members of the ROK family (Fig. 2[link]). The monomer structure has an elongated shape and is composed of two α/β domains that are connected by two hinge loops (residues 119–125 and 269–271). The putative active site is located in a large cleft between the N-terminal domain, which is made of two fragments (residues 1–118 and 272–291), and the slightly smaller C-terminal dimerization domain (residues 126–268). The N-terminal domain contains a central mixed, twisted five-stranded β-sheet (β1–β4 and β7) surrounded by four α-helices (α1–α3 and α11) and a short β-hairpin (β5–β6) (Fig. 3[link]a). The C-terminal dimerization domain consists of a mixed, twisted four-stranded β-sheet (β8–β11) that is sandwiched between the N-terminal domain and a cluster of α-helices and 310-helices of the C-terminal domain (Fig. 3[link]b). Forty residues of the helix cluster and connecting loops of the C-terminal domain create a 1479 Å2 dimer interface stabilized by direct hydrogen bonds and solvent-mediated hydrogen bonds.

[Figure 2]
Figure 2
Overall structure of F. nucleatum apo N-acetylmannosamine kinase. The N-terminal domain is coloured in blue shades, the C-terminal dimerization domain in red shades and the the hinge loops are depicted in yellow. For clarity, based on the human hMNK structure (PDB entry 2yhy), ManNAc (green sticks), ADP (white sticks) and Mg2+ (blue sphere) have been modelled in the putative active site.
[Figure 3]
Figure 3
Overall structures of the N-terminal domain (a) and C-terminal dimerization domain (b). The helices and strands are numbered. The residues that span and flank each domain are marked. Domain 1 starts from the N-terminus and ends at residue 118 and then continues from residue 272 to the C-terminus (blue). Residues 126–268 form the dimerization domain.
3.2.2. The putative active site

In this study, we report an apo structure of FnNanK. The N-acetylmannosamine kinase domain (hMNK) of the human bifunctional UDP-N-acetyl­glucosamine 2-epimerase/N-acetylmannosamine kinase shares 23% sequence identity with FnNanK and has been characterized both functionally and structurally (Martinez et al., 2012[Martinez, J., Nguyen, L. D., Hinderlich, S., Zimmer, R., Tauberger, E., Reutter, W., Saenger, W., Fan, H. & Moniot, S. (2012). J. Biol. Chem. 287, 13656-13665.]). The structure of hMNK in complex with ManNAc and ADP (PDB entry 2yhy) can be superimposed on NanK with an r.m.s. deviation of 2.5 Å for 280 Cα atoms, making it possible to model the binding of ManNAc and ADP in the active site of FnNanK (Fig. 4[link]a). Residues that are involved in substrate and ATP binding are located in both the N-terminal and C-terminal domains. The conserved residues in hMNK (Asn516, Asp517, Arg477, Glu566, His569 and Glu588) that are required for the coordination of ManNAc (Martinez et al., 2012[Martinez, J., Nguyen, L. D., Hinderlich, S., Zimmer, R., Tauberger, E., Reutter, W., Saenger, W., Fan, H. & Moniot, S. (2012). J. Biol. Chem. 287, 13656-13665.]) are superimposable with Asn106, Asp107, Gln67, Glu156, His159 and Glu168 in FnNanK.

[Figure 4]
Figure 4
FnNanK lacks the cysteine-rich zinc-binding motif. (a) Structural comparison of apo FnNanK in red and substrate-bound (ManNAc, ADP and Mg2+) hMNK in green. (b) Superimposition of the substrate-binding regions of bacterial NanKs. The putative residues involved in catalysis in the substrate-binding site in FnNanK (blue) are superimposable with the corresponding residues in NanK from E. coli (EcNanK; PDB entry 2aa4, pink) and L. monocytogenes (LmNanK; PDB entry 4htl, green). The zinc-binding motif is only visible in EcNanK, which is represented by the coordination of Cys173, Cys166, Cys168 and His156 to the Zn atom (grey). The highly conserved histidine that coordinates ManNAc is present in FnNanK and EcNanK but corresponds to a tyrosine in LmNanK.

The bacterial EcNanK (PDB entry 2aa4) and LmNanK structures (PDB entry 4htl) were superimposed with FnNanK. The r.m.s. deviations for the structural alignments of EcNanK (289 Cα atoms) and LmNanK (280 Cα atoms) with FnNanK are 2.6 and 1.9 Å, respectively. The putative active-site residues in FnNanK (Asn106, Asp107, Gln67, Glu156, His159 and Glu168) that are predicted to be involved in substrate binding are superimposable with those in EcNanK (Asn104, Asp105, Ile66, His153, His156 and Glu175) and LmNanK (Asn102, Asp103, Tyr64, Glu152, Tyr155 and Asn172) (Fig. 4[link]b).

3.2.3. FnNanK lacks a zinc-binding site

The common signature motifs of the ROK scaffold are (i) an N-terminal region containing the nucleotide-binding site with a DxGxT sequence motif, (ii) a strictly conserved catalytic aspartate within the active-site loop, (iii) an ExGH motif that interacts with the sugar substrate and (iv) a cysteine-rich zinc-binding motif with sequence CxCGxxGCx(E/D) (Conejo et al., 2010[Conejo, M. S., Thompson, S. M. & Miller, B. G. (2010). J. Mol. Evol. 70, 545-556.]). The first three signature motifs are also conserved in FnNanK.

Although FnNanK retains most of the consensus motifs unique to the ROK family, the lack of a zinc-binding site with sequence xCGxxGCx(E/D) is evident both in the sequence and structure alignments. The zinc-binding motif is implicated in upholding the structural integrity of the active site (Mesak et al., 2004[Mesak, L. R., Mesak, F. M. & Dahl, M. K. (2004). BMC Microbiol. 4, 6.]; Martinez et al., 2012[Martinez, J., Nguyen, L. D., Hinderlich, S., Zimmer, R., Tauberger, E., Reutter, W., Saenger, W., Fan, H. & Moniot, S. (2012). J. Biol. Chem. 287, 13656-13665.]). A recent report suggested that mutation of the cysteines in the zinc-binding motif through site-directed mutagenesis renders Bacillus subtilis glucokinase inactive (Mesak et al., 2004[Mesak, L. R., Mesak, F. M. & Dahl, M. K. (2004). BMC Microbiol. 4, 6.]). The Zn atom is coordinated by three thiols within the cysteine-rich motif and a fourth coordinating conserved histidine relating the zinc-motif region to the substrate-binding site (Schiefner et al., 2005[Schiefner, A., Gerber, K., Seitz, S., Welte, W., Diederichs, K. & Boos, W. (2005). J. Biol. Chem. 280, 29073-29079.]). Superimposition of the residues that are involved both in zinc binding and substrate binding in PDB entries 2aa4 (pink) and 4htl (green) and in FnNanK (blue) highlights the absence of the cysteine-rich region in FnNanK (Fig. 4[link]b).

FnNanK lacks the zinc-binding motif, and sequence analysis of the known N-acetylmannosamine kinases shows that the consensus sequence xCGxxGCx(E/D) which denotes the zinc-motif region is not present in FnNanK. In LmNanK (PDB entry 4htl; Fig. 4[link]b) there seems to be no deletion; however, the loop contains no cysteine residues. The lack of zinc-binding sequence also extends to methicillin-resistant Staphylococcus aureus (MRSA) NanK (North et al., 2013[North, R. A., Kessans, S. A., Atkinson, S. C., Suzuki, H., Watson, A. J. A., Burgess, B. R., Angley, L. M., Hudson, A. O., Varsani, A., Griffin, M. D. W., Fairbanks, A. J. & Dobson, R. C. J. (2013). Acta Cryst. F69, 306-312.]). However, FnNanK retains the highly conserved His159. The corresponding residue is His156 in EcNanK, and this histidine has been shown to bind both to the zinc ion and to ManNAc in human NanK (His569; Nocek et al., 2011[Nocek, B., Stein, A. J., Jedrzejczak, R., Cuff, M. E., Li, H., Volkart, L. & Joachimiak, A. (2011). J. Mol. Biol. 406, 325-342.]; Martinez et al., 2012[Martinez, J., Nguyen, L. D., Hinderlich, S., Zimmer, R., Tauberger, E., Reutter, W., Saenger, W., Fan, H. & Moniot, S. (2012). J. Biol. Chem. 287, 13656-13665.]). Mutations of the two cysteine residues associated with zinc binding to serine and alanine in the E. coli Mlc repressor compromised its repressor function.

The three cysteine residues and histidine residue engaged in zinc-ion coordination are considered to be a distinct motif in the ROK family (Schiefner et al., 2005[Schiefner, A., Gerber, K., Seitz, S., Welte, W., Diederichs, K. & Boos, W. (2005). J. Biol. Chem. 280, 29073-29079.]). Although the three cysteines are not present in FnNanK, His159 is noted to be significantly shifted on superimposition with EcNanK. The measured distance between His159 in FnNanK and the substrate ManNAc in hMNK is twice as far compared with the distance between His569 in hMNK and ManNAc. In FnNanK, the glutamate residue Glu166 is markedly visible in place of the cysteine residues (Fig. 4[link]b). The structure of FnNanK in complex with substrate analogues and ATP (or an analogue) is required to predict the change in conformation that is needed to complete the binding of the substrate and ATP.

4. Concluding remarks

In this paper, we present the crystal structure of apo FnNanK. In addition, we analyze and compare the sequence and structure of FnNanK with those of other N-acetyl­mannosamine kinases that display consensus features of the ROK superfamily. One of these signature motifs is the zinc-binding site, which is reportedly crucial in maintaining the structural integrity of the active site. We find that despite the absence of a zinc-binding motif in FnNanK, the major structural features that are implicated in enzymatic function are not compromised.

Supporting information


Acknowledgements

We thank Richard Neutze for support and input into the manuscript.

Funding information

Funding for this research was provided by: European Union Seventh Framework Programme (award No. 608743); The Swedish Research Council Formas (award No. 2011-1759); The Swedish Research Council (award No. 2011-5790); VINNOVA (award No. 2013-04655); Carl Tryggers Stiftelse för Vetenskaplig Forskning (award No. 11:147); European Molecular Biology Organization (award Nos. 1163-2014, 584-2014); Centre for Antibiotic Resistance Research (CARe) at University of Gothenburg; Indo-Swedish Collaborative Grant from DBT (award No. BT/IN/Sweden/41/SR/2013); Infrastructure Grant for the X-ray Facility from DBT (award No. BT/PR5081/INF/22/156/2012).

References

First citationAdams, P. D. et al. (2011). Methods, 55, 94–106.  Web of Science CrossRef CAS PubMed Google Scholar
First citationAdams, P. D., Pannu, N. S., Read, R. J. & Brunger, A. T. (1999). Acta Cryst. D55, 181–190.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationAlmagro-Moreno, S. & Boyd, E. F. (2009a). BMC Evol. Biol. 9, 118.  Google Scholar
First citationAlmagro-Moreno, S. & Boyd, E. F. (2009b). Infect. Immun. 77, 3807–3816.  Web of Science PubMed CAS Google Scholar
First citationAlmagro-Moreno, S. & Boyd, E. F. (2010). Gut Microbes, 1, 45–50.  PubMed Google Scholar
First citationAngata, T. & Varki, A. (2002). Chem. Rev. 102, 439–469.  Web of Science CrossRef PubMed CAS Google Scholar
First citationBattye, T. G. G., Kontogiannis, L., Johnson, O., Powell, H. R. & Leslie, A. G. W. (2011). Acta Cryst. D67, 271–281.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationConejo, M. S., Thompson, S. M. & Miller, B. G. (2010). J. Mol. Evol. 70, 545–556.  Web of Science CrossRef CAS PubMed Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEvans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204–1214.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationHaines-Menges, B. L., Whitaker, W. B., Lubin, J. B. & Boyd, E. F. (2015). Microbiol. Spectr. 3, 321–342.  Google Scholar
First citationKazatchkine, M. D., Fearon, D. T. & Austen, K. F. (1979). J. Immunol. 122, 75–81.  CAS PubMed Google Scholar
First citationLanoue, A., Batista, F. D., Stewart, M. & Neuberger, M. S. (2002). Eur. J. Immunol. 32, 348–355.  CrossRef PubMed CAS Google Scholar
First citationMartinez, J., Nguyen, L. D., Hinderlich, S., Zimmer, R., Tauberger, E., Reutter, W., Saenger, W., Fan, H. & Moniot, S. (2012). J. Biol. Chem. 287, 13656–13665.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMesak, L. R., Mesak, F. M. & Dahl, M. K. (2004). BMC Microbiol. 4, 6.  Google Scholar
First citationMulligan, C., Fischer, M. & Thomas, G. H. (2011). FEMS Microbiol. Rev. 35, 68–86.  CrossRef CAS PubMed Google Scholar
First citationNocek, B., Stein, A. J., Jedrzejczak, R., Cuff, M. E., Li, H., Volkart, L. & Joachimiak, A. (2011). J. Mol. Biol. 406, 325–342.  Web of Science CrossRef CAS PubMed Google Scholar
First citationNorth, R. A., Kessans, S. A., Atkinson, S. C., Suzuki, H., Watson, A. J. A., Burgess, B. R., Angley, L. M., Hudson, A. O., Varsani, A., Griffin, M. D. W., Fairbanks, A. J. & Dobson, R. C. J. (2013). Acta Cryst. F69, 306–312.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationRead, R. J. (2001). Acta Cryst. D57, 1373–1382.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationSchiefner, A., Gerber, K., Seitz, S., Welte, W., Diederichs, K. & Boos, W. (2005). J. Biol. Chem. 280, 29073–29079.  CrossRef PubMed CAS Google Scholar
First citationTanner, M. E. (2005). Bioorg. Chem. 33, 216–228.  CrossRef PubMed CAS Google Scholar
First citationTitgemeyer, F., Reizer, J., Reizer, A. & Saier, M. H. Jr (1994). Microbiology, 140, 2349–2354.  CrossRef CAS PubMed Google Scholar
First citationTong, Y., Tempel, W., Nedyalkova, L., Mackenzie, F. & Park, H.-W. (2009). PLoS One, 4, e7165.  CrossRef PubMed Google Scholar
First citationVarki, A. (1992). Glycobiology, 2, 25–40.  CrossRef PubMed CAS Web of Science Google Scholar
First citationVarki, A. (2007). Nature (London), 446, 1023–1029.  CrossRef PubMed CAS Google Scholar
First citationVimr, E. R. (2013). ISRN Microbiol. 2013, 816713.  Google Scholar
First citationVimr, E. R., Kalivoda, K. A., Deszo, E. L. & Steenbergen, S. M. (2004). Microbiol. Mol. Biol. Rev. 68, 132–153.  Web of Science CrossRef PubMed CAS Google Scholar
First citationVimr, E. R. & Troy, F. A. (1985). J. Bacteriol. 164, 854–860.  CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds