research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Structure of the outer membrane porin OmpW from the pervasive pathogen Klebsiella pneumoniae

crossmark logo

aDepartment of Life Sciences, Imperial College, London, United Kingdom, and bRutherford Appleton Laboratory, Research Complex at Harwell, Didcot OX11 0FA, United Kingdom
*Correspondence e-mail: [email protected]

Edited by G. G. Privé, University of Toronto, Canada (Received 1 November 2023; accepted 11 December 2023)

Conjugation is the process by which plasmids, including those that carry antibiotic-resistance genes, are mobilized from one bacterium (the donor) to another (the recipient). The conjugation efficiency of IncF-like plasmids relies on the formation of mating-pair stabilization via intimate interactions between outer membrane proteins on the donor (a plasmid-encoded TraN isoform) and recipient bacteria. Conjugation of the R100-1 plasmid into Escherichia coli and Klebsiella pneumoniae (KP) recipients relies on pairing between the plasmid-encoded TraNα in the donor and OmpW in the recipient. Here, the crystal structure of K. pneumoniae OmpW (OmpWKP) is reported at 3.2 Å resolution. OmpWKP forms an eight-stranded β-barrel flanked by extracellular loops. The structures of E. coli OmpW (OmpWEC) and OmpWKP show high conservation despite sequence variability in the extracellular loops.

1. Introduction

Outer membrane porins (OMPs) are an important class of β-barrel proteins that form water-filled channels in Gram-negative bacteria. They enable the diffusion of nutrients and the efflux of toxins across the outer membrane (Lou et al., 2009[Lou, H., Beis, K. & Naismith, J. H. (2009). Curr. Top. Membr. 63, 269-297.]). From a clinical perspective, OMPs are important in modulating the diffusion of antibiotics into the bacterial cell, where mutations or reduced expression of the OMPs enhance antibiotic resistance (Pagès et al., 2008[Pagès, J., James, C. E. & Winterhalter, M. (2008). Nat. Rev. Microbiol. 6, 893-903.]). It has also been shown that OMPs participate in F-like plasmid conjugation, a form of horizontal gene transfer where plasmids are transferred from donor to recipient bacteria in a contact-dependent manner (Lederberg & Tatum, 1946[Lederberg, J. & Tatum, E. L. (1946). Nature, 158, 558.]; Frankel et al., 2023[Frankel, G., David, S., Low, W. W., Seddon, C., Wong, J. C. & Beis, K. (2023). Nucleic Acids Res. 51, 8925-8933.]). We have recently shown that the efficient conjugation of the multidrug-resistant R100-1 plasmid into both Escherichia coli (EC) and Klebsiella pneumoniae (KP) relies on the formation of mating-pair stabilization via interaction between the R100-1-encoded OM protein TraNα in the donor and the OMP OmpWEC or OmpWKP in the recipient (Low et al., 2022[Low, W. W., Wong, J. L. C., Beltran, L. C., Seddon, C., David, S., Kwong, H., Bizeau, T., Wang, F., Peña, A., Costa, T. R. D., Pham, B., Chen, M., Egelman, E. H., Beis, K. & Frankel, G. (2022). Nat. Microbiol. 7, 1016-1027.], 2023[Low, W. W., Seddon, C., Beis, K. & Frankel, G. (2023). J. Bacteriol. 205, e00061-23.]). Pairing of the TraN isoform with recipient receptors mediates conjugation species specificity and host range; an in-depth review of mating-pair stabilization and the role of TraN has been provided by Frankel et al. (2023[Frankel, G., David, S., Low, W. W., Seddon, C., Wong, J. C. & Beis, K. (2023). Nucleic Acids Res. 51, 8925-8933.]). In brief, TraN is an outer membrane protein that is composed of two domains, a base and an extended tip; the base consists of a conserved amphipathic α-helix that possibly anchors TraN to the OM, whereas the tip is mostly comprised of β-sheets linked to a β-sandwich domain. The loops at the tip function as a TraN sensor that participates in recipient selection (Frankel et al., 2023[Frankel, G., David, S., Low, W. W., Seddon, C., Wong, J. C. & Beis, K. (2023). Nucleic Acids Res. 51, 8925-8933.])

In addition to its role in conjugation, OmpW contributes to virulence as the upregulation of OmpWEC increases resistance to host immune defence (Wu et al., 2013[Wu, X., Tian, L., Zou, H., Wang, C., Yu, Z., Tang, C., Zhao, F. & Pan, J. (2013). Res. Microbiol. 164, 848-855.]). Conversely, OmpW is a key antigen; indeed, OmpW-immunized mice show greater protection against bacterial infections. This could pave the way for the use of OmpW in vaccine preparation (Huang et al., 2015[Huang, W., Wang, S., Yao, Y., Xia, Y., Yang, X., Long, Q., Sun, W., Liu, C., Li, Y. & Ma, Y. (2015). Vaccine, 33, 4479-4485.]).

The crystal structure of OmpWEC forms an eight-stranded monomeric β-barrel with an extracellular region that is involved in hydrophobic substrate binding (Hong et al., 2006[Hong, H., Patel, D. R., Tamm, L. K. & van den Berg, B. (2006). J. Biol. Chem. 281, 7568-7577.]). Here, we present the crystal structure of OmpWKP at 3.2 Å resolution and draw structural comparisons with OmpWEC, both of which are conjugation receptors for TraNα.

2. Materials and methods

2.1. Macromolecule production

The mature protein sequence of OmpWKP (His22–Phe212) was subcloned into the pTAMANHISTEV vector in-frame with a tamA signal sequence followed by an N-terminal His7 tag and a Tobacco etch virus (TEV) cleavage site, using the NcoI and XhoI restriction-enzyme sites. The construct was transformed into E. coli BL21 C43(DE3) competent cells [F ompT hsdSB Mathematical equation Mathematical equation gal dcm (DE3)] (Miroux & Walker, 1996[Miroux, B. & Walker, J. E. (1996). J. Mol. Biol. 260, 289-298.]) and expressed in Terrific Broth (TB) medium. Cultures were incubated at 37°C with orbital shaking at 200 rev min−1 until an optical density at 600 nm (OD600) of 0.6–0.8 was achieved. Cultures were then induced with isopropyl β-D-1-thiogalactopyranoside (IPTG) at a final concentration of 1 mM and maintained for 3 h. The cells were harvested by centrifugation (Beckman Coulter) at 8000g for 10 min and stored at −80°C. Outer membranes were prepared as described previously (Beis et al., 2006[Beis, K., Whitfield, C., Booth, I. & Naismith, J. H. (2006). Int. J. Biol. Macromol. 39, 10-14.]) and were then solubilized in phosphate-buffered saline (PBS) supplemented with 1% N,N-dimethyl-n-dodecylamine N-oxide (LDAO) overnight. Unsolubilized membranes and debris were removed by ultracentrifugation at 131 000g for 1 h. The supernatant was supplemented with 30 mM imidazole and passed through a 5 ml HisTrap HP column (Cytiva) equilibrated in PBS with 0.1% LDAO. The column was washed with 20 column volumes of buffer consisting of PBS, 300 mM NaCl, 30 mM imidazole pH 7.0 and 0.45% 1-O-(n-octyl)-tetraethyleneglycol (C8E4) to exchange the detergent. OmpWKP was eluted in buffer consisting of 250 mM imidazole and 0.45% C8E4. OmpWKP was then exchanged into 50 mM NaCl, 10 mM HEPES pH 7.0 and 0.45% C8E4 using a PD-10 Desalting Column (Cytiva) and concentrated to 15 mg ml−1. Macromolecule-production information is summarized in Table 1[link].

Table 1
OmpWKP construct design

Source organism Klebsiella pneumoniae
DNA source K. pneumoniae ICC8001
Forward primer CATGCCATGGGTCATGAGGCGGGGGAGTTTTTC
Reverse primer CCGCTCGAGTTAGAACCGATAGCCTGCGGAGAA
Cloning vector pTAMANHISTEV
Expression vector pTAMANHISTEV
Expression host E. coli
Complete amino-acid sequence of the construct produced§ MRYIRQLCCVSLLCLSGSAAAANVRLQHHHHHHHDYDIPTTENLYFQGAMGHEAGEFFIRAGTATVRPTEGSDNVLGSLGSFNVSNNTQLGLTFTYMATDNIGVELLAATPFRHKVGTGPTGTIATVHQLPPTLMAQWYFGDAQSKVRPYVGAGINYTTFFNEDFNDTGKAAGLSDLSLKDSWGAAGQVGLDYLINRDWLLNMSVWYMDIDTDVKFKAGGVDQKVSTRLDPWVFMFSAGYRF
†The NcoI restriction site is underlined.
‡The XhoI restriction site is underlined.
§The pTAMA signal sequence that is not present after cleavage is underlined.

2.2. Crystallization

Purified OmpWKP underwent preliminary screening by the sitting-drop vapour-diffusion method at 293 K using the sparse-matrix MemGold screen (Molecular Dimensions). The protein was mixed with the precipitant in a 1:1 ratio using a Mosquito LCP crystallization robot (SPT Labtech). Orthorhombic crystals appeared after 24 h in the following condition: 0.35 M lithium sulfate, 0.1 M sodium acetate pH 4.0, 11% PEG 600. Large OmpWKP crystals were obtained by the hanging-drop vapour-diffusion method. Crystals were cryoprotected in a mixture of well solution supplemented with 30% PEG 600.

2.3. Data collection and processing

Diffraction data were collected on the I03 beamline at Diamond Light Source (DLS), Didcot, United Kingdom using an EIGER2 XE 16M detector. The crystals belonged to space group C222. Diffraction frames were indexed and integrated using the DIALS pipeline as implemented at DLS (Winter et al., 2018[Winter, G., Waterman, D. G., Parkhurst, J. M., Brewster, A. S., Gildea, R. J., Gerstel, M., Fuentes-Montero, L., Vollmar, M., Michels-Clark, T., Young, I. D., Sauter, N. K. & Evans, G. (2018). Acta Cryst. D74, 85-97.]). The data were scaled using AIMLESS in the CCP4 suite (Evans & Murshudov, 2013[Evans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204-1214.]; Agirre et al., 2023[Agirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449-461.]). The data-collection parameters and merging statistics are summarized in Table 2[link].

Table 2
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source I03, DLS
Wavelength (Å) 0.9763
Temperature (K) 100
Detector EIGER2 XE 16M
Space group C222
a, b, c (Å) 87.92, 138.63, 52.96
α, β, γ (°) 90.0, 90.0, 90.0
Mosaicity (°) 0.15
Resolution range (Å) 52.9–3.2 (3.3–3.2)
Total No. of reflections 71778 (7496)
No. of unique reflections 5639 (560)
Completeness (%) 100 (100)
Multiplicity 12.7 (13.4)
CC1/2 0.85 (0.99)
I/σ(I)〉 64 (2.5)
Rr.i.m. 0.082 (0.207)
Overall B factor from Wilson plot (Å2) 78.7

2.4. Structure solution, model building and refinement

The structure of OmpWKP was solved by molecular replace­ment with the AlphaFold-predicted model of OmpWKP (Jumper et al., 2021[Jumper, J., Evans, R., Pritzel, A., Green, T., Figurnov, M., Ronneberger, O., Tunyasuvunakool, K., Bates, R., Žídek, A., Potapenko, A., Bridgland, A., Meyer, C., Kohl, S. A. A., Ballard, A. J., Cowie, A., Romera-Paredes, B., Nikolov, S., Jain, R., Adler, J., Back, T., Petersen, S., Reiman, D., Clancy, E., Zielinski, M., Steinegger, M., Pacholska, M., Berghammer, T., Bodenstein, S., Silver, D., Vinyals, O., Senior, A. W., Kavukcuoglu, K., Kohli, P. & Hassabis, D. (2021). Nature, 596, 583-589.]) using Phenix (Liebschner et al., 2019[Liebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861-877.]). The calculated Matthews coefficient (VM) was 3.84 Å3 Da−1, suggesting the presence of one molecule of OmpWKP in the asymmetric unit; this corresponds to a solvent content of 68% by volume. Manual adjustments to the model were performed in Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). Density for two sulfate ions was present and they were included in the model. Phenix was used for refinement (Afonine et al., 2018[Afonine, P. V., Poon, B. K., Read, R. J., Sobolev, O. V., Terwilliger, T. C., Urzhumtsev, A. & Adams, P. D. (2018). Acta Cryst. D74, 531-544.]). MolProbity was used for validation (Williams et al., 2018[Williams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B. III, Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, D. C. (2018). Protein Sci. 27, 293-315.]). Figure preparation was performed using UCSF ChimeraX 1.6 (Pettersen et al., 2021[Pettersen, E. F., Goddard, T. D., Huang, C. C., Meng, E. C., Couch, G. S., Croll, T. I., Morris, J. H. & Ferrin, T. E. (2021). Protein Sci. 30, 70-82.]). Refinement statistics are summarized in Table 3[link].

Table 3
Structure solution and refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 52.97–3.20 (3.31–3.20)
Completeness (%) 100 (100)
No. of reflections, working set 5633 (559)
No. of reflections, test set 236 (25)
Final Rcryst 0.2668 (0.2646)
Final Rfree 0.3117 (0.3636)
No. of non-H atoms
 Protein 1388
 Ion 10
 Total 1398
R.m.s. deviations
 Bond lengths (Å) 0.003
 Angles (°) 0.622
Average B factors (Å2) 77.7
 Protein 77.5
 Ion 101.8
Ramachandran plot
 Most favoured (%) 95.98
 Allowed (%) 3.45
 Outliers (%) 0.57 [Pro113]

3. Results and discussion

3.1. Purification and crystallization of OmpWKP

OmpWKP was overexpressed in E. coli and purified in C8E4 to homogeneity by immobilized metal affinity chromatography. OmpWKP displays a monodisperse peak on size-exclusion chromatography and was >95% pure as judged by SDS–PAGE (Fig. 1[link]a). OmpWKP crystals grew overnight from a solution consisting of 0.35 M lithium sulfate, 0.1 M sodium acetate pH 4.0, 11%(w/v) PEG 600 (Fig. 1[link]b). The crystals had an orthorhombic shape and were further optimized by the hanging-drop vapour-diffusion method. The optimized crystals diffracted X-rays to 3.2 Å resolution and belonged to space group C222.

[Figure 1]
Figure 1
Purification and crystallization of OmpWKP. (a) SEC analysis of OmpWKP shows a monodisperse peak, with SDS–PAGE analysis of purified OmpWKP; the purity is greater than 95%. (b) Orthorhombic OmpWKP crystals. The largest crystals had dimensions of 100 × 20 × 20 µm.

3.2. Structure solution of OmpWKP

The structure of OmpWKP was solved by molecular replace­ment using the AlphaFold-predicted model. Continuous electron density could be observed for most of the structure except for Gly41–Phe52, which were omitted from model building. The OmpWKP structure consists of eight antiparallel β-strands (β1–β8) that arrange to form a hollow β-barrel in the OM and an extracellular solvent-exposed region (Fig. 2[link]a). The extracellular region is formed from the extended β-strands of the barrel and a single α-helical turn (α1) connecting β5 and β6. A hydrophobic gate is present midway through the channel consisting of residues Leu89 and Trp188, as in OmpWEC (Hong et al., 2006[Hong, H., Patel, D. R., Tamm, L. K. & van den Berg, B. (2006). J. Biol. Chem. 281, 7568-7577.]), where the extracellular entrance to the channel is lined with hydrophobic residues (Fig. 2[link]b).

[Figure 2]
Figure 2
Structure of OmpWKP. (a) Cartoon representation of the OmpWKP structure (shown in green) perpendicular to the OM (depicted in grey). Sulfate ions are depicted as sticks (O atoms are shown in red and S atoms in yellow). The missing residues are marked with a green dashed line. (b) The hydrophobic residues lining the extracellular region and forming the hydrophobic gate, Leu89 and Trp188, are shown as orange sticks.

3.3. Comparison of OmpWKP with OmpWEC

The closest structural homologue to OmpWKP is OmpWEC, which shares 82.7% sequence identity and 88% sequence similarity (Fig. 3[link]a). The two structures can be superimposed with an r.m.s.d. of 0.54 Å over 171 Cα atoms (Fig. 3[link]b); they show high structural conservation of the β-barrel, with minor differences confined to the extracellular region, which displays some flexibility. The extracellular loop 1 that connects β1 and β2 is missing in both the OmpWKP and the OmpWEC structures, suggesting a highly flexible structure. This flexibility could be associated with substrate recruitment, as the conformation of the modelled loop 1 blocks the channel in the AlphaFold-predicted structure. In the OmpWEC structure an LDAO molecule is bound at the extracellular region but loop 1 is not fully resolved, suggesting that the inherited flexibility cannot be stabilized upon its binding (Hong et al., 2006[Hong, H., Patel, D. R., Tamm, L. K. & van den Berg, B. (2006). J. Biol. Chem. 281, 7568-7577.]). This highly mobile structural element on the extracellular loop is likely to shield the hydrophobic face of the extracellular region and it could transiently open to recruit hydrophobic substrates. Despite the sequence conservation of loop 1 being low between OmpWKP and OmpWEC, this suggests that it might be involved in substrate selectivity between different bacterial species.

[Figure 3]
Figure 3
Sequence alignment and superimposition of OmpWKP with OmpWEC. (a) A sequence alignment of OmpWEC (UniProt ID P0A915) and OmpWKP (UniProt ID W9B759) is shown; conserved and similar residues are shown in red and blue boxes, respectively. Residue numbers are indicated above the protein sequences. An asterisk indicates the mature protein after cleavage of the signal peptide. The alignment was prepared using ESPript (Robert & Gouet, 2014[Robert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320-W324.]). (b) OmpWKP (green) superimposed with OmpWEC (grey; PDB entry 2f1v; Hong et al., 2006[Hong, H., Patel, D. R., Tamm, L. K. & van den Berg, B. (2006). J. Biol. Chem. 281, 7568-7577.]) shows high structural conservation. The LDAO molecule bound to OmpWEC is shown as sticks. (c) Close-up view of the extracellular regions of OmpWKP (green) and OmpWEC (grey), with the side chains of amino-acid differences shown as stick models. The conserved Ala142 is shown in magenta.

Despite amino-acid differences in the extracellular region between OmpWKP and OmpWEC (Fig. 3[link]c), where the tip of TraNR100-1 has been shown to bind (Low et al., 2023[Low, W. W., Seddon, C., Beis, K. & Frankel, G. (2023). J. Bacteriol. 205, e00061-23.]), binding of TraNR100-1 is not impaired between the two species. We previously reported that Ala142, which is conserved between OmpWKP and OmpWEC, acts as the minimum residue for specificity towards TraNR100-1 (Low et al., 2023[Low, W. W., Seddon, C., Beis, K. & Frankel, G. (2023). J. Bacteriol. 205, e00061-23.]); the equivalent residue in Citrobacter rodentium OmpW (OmpWCR) is Asn142, which prevents R100-1 conjugation because of a steric clash with the tip of TraNR100-1 (Low et al., 2023[Low, W. W., Seddon, C., Beis, K. & Frankel, G. (2023). J. Bacteriol. 205, e00061-23.]). The N142A mutation in OmpWCR restored conjugation efficiency (Low et al., 2023[Low, W. W., Seddon, C., Beis, K. & Frankel, G. (2023). J. Bacteriol. 205, e00061-23.]).

In conclusion, we have resolved the crystal structure of OmpWKP; structural comparison with OmpWEC identified the presence of a highly flexible loop, loop 1, that might be important for shielding the pore prior to hydrophobic substrate recruitment. In addition, despite sequence and structural differences in the extracellular region, both porins can mediate interactions with TraNα.

Supporting information


Acknowledgements

We would like to thank Diamond Light Source for beam time on I03.

Funding information

This work was carried out with the funding of a BBSRC DTP Studentship grant (BB/M011178/1).

References

First citationAfonine, P. V., Poon, B. K., Read, R. J., Sobolev, O. V., Terwilliger, T. C., Urzhumtsev, A. & Adams, P. D. (2018). Acta Cryst. D74, 531–544.  Web of Science CrossRef IUCr Journals Google Scholar
First citationAgirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449–461.  Web of Science CrossRef IUCr Journals Google Scholar
First citationBeis, K., Whitfield, C., Booth, I. & Naismith, J. H. (2006). Int. J. Biol. Macromol. 39, 10–14.  CrossRef PubMed CAS Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationEvans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204–1214.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFrankel, G., David, S., Low, W. W., Seddon, C., Wong, J. C. & Beis, K. (2023). Nucleic Acids Res. 51, 8925–8933.  CrossRef PubMed Google Scholar
First citationHong, H., Patel, D. R., Tamm, L. K. & van den Berg, B. (2006). J. Biol. Chem. 281, 7568–7577.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHuang, W., Wang, S., Yao, Y., Xia, Y., Yang, X., Long, Q., Sun, W., Liu, C., Li, Y. & Ma, Y. (2015). Vaccine, 33, 4479–4485.  CrossRef CAS PubMed Google Scholar
First citationJumper, J., Evans, R., Pritzel, A., Green, T., Figurnov, M., Ronneberger, O., Tunyasuvunakool, K., Bates, R., Žídek, A., Potapenko, A., Bridgland, A., Meyer, C., Kohl, S. A. A., Ballard, A. J., Cowie, A., Romera-Paredes, B., Nikolov, S., Jain, R., Adler, J., Back, T., Petersen, S., Reiman, D., Clancy, E., Zielinski, M., Steinegger, M., Pacholska, M., Berghammer, T., Bodenstein, S., Silver, D., Vinyals, O., Senior, A. W., Kavukcuoglu, K., Kohli, P. & Hassabis, D. (2021). Nature, 596, 583–589.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLederberg, J. & Tatum, E. L. (1946). Nature, 158, 558.  CrossRef PubMed Google Scholar
First citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
First citationLou, H., Beis, K. & Naismith, J. H. (2009). Curr. Top. Membr. 63, 269–297.  CrossRef CAS Google Scholar
First citationLow, W. W., Seddon, C., Beis, K. & Frankel, G. (2023). J. Bacteriol. 205, e00061-23.  CrossRef PubMed Google Scholar
First citationLow, W. W., Wong, J. L. C., Beltran, L. C., Seddon, C., David, S., Kwong, H., Bizeau, T., Wang, F., Peña, A., Costa, T. R. D., Pham, B., Chen, M., Egelman, E. H., Beis, K. & Frankel, G. (2022). Nat. Microbiol. 7, 1016–1027.  CrossRef CAS PubMed Google Scholar
First citationMiroux, B. & Walker, J. E. (1996). J. Mol. Biol. 260, 289–298.  CrossRef CAS PubMed Web of Science Google Scholar
First citationPagès, J., James, C. E. & Winterhalter, M. (2008). Nat. Rev. Microbiol. 6, 893–903.  PubMed Google Scholar
First citationPettersen, E. F., Goddard, T. D., Huang, C. C., Meng, E. C., Couch, G. S., Croll, T. I., Morris, J. H. & Ferrin, T. E. (2021). Protein Sci. 30, 70–82.  Web of Science CrossRef CAS PubMed Google Scholar
First citationRobert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320–W324.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWilliams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B. III, Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, D. C. (2018). Protein Sci. 27, 293–315.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWinter, G., Waterman, D. G., Parkhurst, J. M., Brewster, A. S., Gildea, R. J., Gerstel, M., Fuentes-Montero, L., Vollmar, M., Michels-Clark, T., Young, I. D., Sauter, N. K. & Evans, G. (2018). Acta Cryst. D74, 85–97.  Web of Science CrossRef IUCr Journals Google Scholar
First citationWu, X., Tian, L., Zou, H., Wang, C., Yu, Z., Tang, C., Zhao, F. & Pan, J. (2013). Res. Microbiol. 164, 848–855.  CrossRef CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds