research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Co-crystal structure of Helicobacter pylori biotin protein ligase with biotinyl-5-ATP

crossmark logo

aDartmouth Cancer Center, One Medical Center Drive, Lebanon, NH 03756, USA, bCollege of Arts and Science, Dartmouth College, Hanover, NH 03755, USA, cCenter for Global Infectious Disease Research, Seattle Children's Research Institute, 307 Westlake Avenue North, Suite 500, Seattle, WA 98109, USA, dSeattle Structural Genomics Center for Infectious Diseases, Seattle, Washington, USA, and eUCB BioSciences, Bainbridge Island, WA 98110, USA
*Correspondence e-mail: [email protected]

Edited by J. Agirre, University of York, United Kingdom (Received 30 July 2024; accepted 11 December 2024)

This article is part of a focused issue on empowering education through structural genomics.

Helicobacter pylori, a type 1 carcinogen that causes human gastric ulcers and cancer, is a priority target of the Seattle Structural Genomics Center for Infectious Disease (SSGCID). These efforts include determining the structures of potential H. pylori therapeutic targets. Here, the purification, crystallization and X-ray structure of one such target, H. pylori biotin protein ligase (HpBPL), are reported. HpBPL catalyzes the activation of various biotin-dependent metabolic pathways, including fatty-acid synthesis, gluconeogenesis and amino-acid catabolism, and may facilitate the survival of H. pylori in the high-pH gastric mucosa. HpBPL is a prototypical bacterial biotin protein ligase, despite having less than 35% sequence identity to any reported structure in the Protein Data Bank. A biotinyl-5-ATP molecule sits in a well conserved cavity. HpBPL shares extensive tertiary-structural similarity with Mycobacterium tuberculosis biotin protein ligase (MtBPL), despite having less than 22% sequence identity. The active site of HpBPL is very similar to that of MtBPL and has the necessary residues to bind inhibitors developed for MtBPL.

1. Introduction

Over half of the human population is infected with Helicobacter pylori, a spiral-shaped, flagellated, Gram-negative bacterium that is highly adapted for human colonization (Warren & Marshall, 1983[Warren, J. R. & Marshall, B. (1983). Lancet, 1, 1273-1275.]; Malfertheiner et al., 2023[Malfertheiner, P., Camargo, M. C., El-Omar, E., Liou, J. M., Peek, R., Schulz, C., Smith, S. I. & Suerbaum, S. (2023). Nat. Rev. Dis. Primers, 9, 19.]; Moss et al., 2023[Moss, S. F., Chey, W. D., Daniele, P., Pelletier, C., Jacob, R., Tremblay, G., Hubscher, E., Leifke, E. & Malfertheiner, P. (2023). Ther. Adv. Gastroenterol. 16, 17562848231167284.]). The presence of H. pylori increases the risk of noncardiac gastric adenocarcinoma, gastric lymphoma and peptic ulcer (Malfertheiner et al., 2023[Malfertheiner, P., Camargo, M. C., El-Omar, E., Liou, J. M., Peek, R., Schulz, C., Smith, S. I. & Suerbaum, S. (2023). Nat. Rev. Dis. Primers, 9, 19.]; Moss et al., 2023[Moss, S. F., Chey, W. D., Daniele, P., Pelletier, C., Jacob, R., Tremblay, G., Hubscher, E., Leifke, E. & Malfertheiner, P. (2023). Ther. Adv. Gastroenterol. 16, 17562848231167284.]; Cover & Blaser, 2009[Cover, T. L. & Blaser, M. J. (2009). Gastroenterology, 136, 1863-1873.]). H. pylori was classified as a type 1 carcinogen in 1994 by the International Agency for Research on Cancer (Ahn & Lee, 2015[Ahn, H. J. & Lee, D. S. (2015). World J. Gastrointest. Oncol. 7, 455-465.]; Malfertheiner et al., 2023[Malfertheiner, P., Camargo, M. C., El-Omar, E., Liou, J. M., Peek, R., Schulz, C., Smith, S. I. & Suerbaum, S. (2023). Nat. Rev. Dis. Primers, 9, 19.]). The unique metabolic adaptations of H. pylori that support persistence in the harsh gastric mucosa include utilizing molecular hydrogen (H2) as an energy source, driving a chemolithoautotrophic growth mode (Kuhns et al., 2016[Kuhns, L. G., Benoit, S. L., Bayyareddy, K., Johnson, D., Orlando, R., Evans, A. L., Waldrop, G. L. & Maier, R. J. (2016). J. Bacteriol. 198, 1423-1428.]). This growth mode allows H. pylori to achieve higher growth yields and increased carbon fixation from bicarbonate under hydrogen-rich conditions such as in the gastric mucosa (Benoit et al., 2020[Benoit, S. L., Maier, R. J., Sawers, R. G. & Greening, C. (2020). Microbiol. Mol. Biol. Rev. 84, e00092-19.]). Furthermore, increasing antimicrobial resistance of H. pylori has been reported (Elbehiry et al., 2023[Elbehiry, A., Marzouk, E., Aldubaib, M., Abalkhail, A., Anagreyyah, S., Anajirih, N., Almuzaini, A. M., Rawway, M., Alfadhel, A., Draz, A. & Abu-Okail, A. (2023). Antibiotics, 12, 191.]). H. pylori is a priority target of the Seattle Structural Genomics Center for Infectious Disease (SSGCID). These efforts include structural studies of H. pylori proteins for rational drug discovery or repurposing. Here, we present structural studies on one of these proteins, H. pylori biotin protein ligase (HpBPL), which catalyzes the transfer of biotin to biotin-accepting proteins. HpBPL is vital for the structural integrity of the bacterial cell wall, and the Mycobacterium tuberculosis homolog has been investigated as a drug target (Duckworth et al., 2011[Duckworth, B. P., Geders, T. W., Tiwari, D., Boshoff, H. I., Sibbald, P. A., Barry, C. E. III, Schnappinger, D., Finzel, B. C. & Aldrich, C. C. (2011). Chem. Biol. 18, 1432-1441.]; Gupta et al., 2010[Gupta, V., Gupta, R. K., Khare, G., Salunke, D. M., Surolia, A. & Tyagi, A. K. (2010). PLoS One, 5, e9222.]). HpBPL is required for essential metabolic pathways, including fatty-acid synthesis, gluconeogenesis and amino-acid catabolism (Burns et al., 1995[Burns, B. P., Hazell, S. L. & Mendz, G. L. (1995). Microbiology, 141, 3113-3118.]). HpBPL does not share any appreciable sequence identity with human proteins, making it an attractive target for drug discovery. Here, we report the production, crystallization and 2.25 Å resolution structure of HpBPL.

2. Materials and methods

2.1. Macromolecule production

HpBPL was cloned, expressed and purified as described previously (Stacy et al., 2011[Stacy, R., Begley, D. W., Phan, I., Staker, B. L., Van Voorhis, W. C., Varani, G., Buchko, G. W., Stewart, L. J. & Myler, P. J. (2011). Acta Cryst. F67, 979-984.]; Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]; Rodríguez-Hernández et al., 2023[Rodríguez-Hernández, D., Vijayan, K., Zigweid, R., Fenwick, M. K., Sankaran, B., Roobsoong, W., Sattabongkot, J., Glennon, E. K. K., Myler, P. J., Sunnerhagen, P., Staker, B. L., Kaushansky, A. & Grøtli, M. (2023). Nat. Commun. 14, 5408.]). The full-length gene for biotin acetyl coenzyme A carboxylase synthetase from H. pylori G27 (UniProt B5Z8D8) encoding amino acids 1–212 was PCR-amplified from genomic DNA using the primers shown in Table 1[link]. The gene was cloned into the expression vector BG1861 to generate plasmid DNA, which was transformed into chemically competent Escherichia coli BL21(DE3) Rosetta cells. The plasmid containing His-HpBPL was tested for expression and 2 l of culture was grown using auto-induction medium (Studier, 2005[Studier, F. W. (2005). Protein Expr. Purif. 41, 207-234.]) in a LEX Bioreactor (Epiphyte Three) as described previously (Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]). The expression clone is available for request online at https://www.ssgcid.org/available-materials/expression-clones/.

Table 1
Macromolecule-production information

Source organism Helicobacter pylori (strain G27)
DNA source Nina Salama, Fred Hutchinson Cancer Research Center
Forward primer 5′-CTCACCACCACCACCACCATATGAGACAATGTGAAAAAAGAGTTTTT-3′
Reverse primer 5′-ATCCTATCTTACTCACTTACATCCTATCATAAATCTTACCTTTAAT-3′
Expression vector BG1861
Expression host Escherichia coli BL21(DE3)R3 Rosetta
Complete amino-acid sequence of the construct produced† MAHHHHHHMRQCEKRVFDSLPSTQTYLLEKLKNNELKAPILIVAKNQSTGIGSRGNIWEGTKSALTFSLALNASDLPKDLPMQANALYLGFLFKEVLKELGSQTWLKWPNDLYLGDQKIGGVLVNVYKGMRVCGIGVNRVSKKWACLDIGASDDLIIEGFLKKIEENLFWGEVLSKYALEFHRSNSFSFHNDWGELVSLKDAELLEDGRICIKGKIYDRM
†The additional N-terminal amino-acid residues are in bold.

HpBPL was purified using a previously described two-step protocol consisting of an immobilized metal (Ni2+) affinity chromatography (IMAC) step followed by size-exclusion chromatography (SEC) on an ÄKTApurifier 10 (GE Healthcare) using automated IMAC and SEC programs (Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]). Briefly, thawed bacterial pellets (25 g) were lysed by sonication in 200 ml lysis buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 0.5%(w/v) CHAPS, 30 mM imidazole, 10 mM MgCl2, 400 µg ml−1 lysozyme, 3 U ml−1 Benzonase]. After sonication, nucleic acids were degraded by incubation with 20 µl (25 U ml−1) Benzonase with mixing for 45 min at room temperature. The lysate was clarified by centrifugation at 10 000 rev min−1 for 1 h using a Sorvall centrifuge (Thermo Scientific). The clarified supernatant was then passed over an Ni–NTA HisTrap FF 5 ml column (GE Healthcare) which had been pre-equilibrated with wash buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 30 mM imidazole pH 7.0]. The column was washed with 20 column volumes (CV) of wash buffer and eluted with elution buffer [20 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 500 mM imidazole pH 7.0] over a 7 CV linear gradient. The peak fractions were pooled and concentrated to 5 ml for size-exclusion chromatography (SEC). For SEC, the 5 ml protein sample was loaded onto a Superdex 75 26/60 column (GE Biosciences) attached to an ÄKTAprime plus FPLC system (GE Biosciences) that had been pre-equilibrated with SEC buffer [20 mM HEPES, pH 7.0, 300 mM NaCl, 5%(v/v) glycerol, 1 mM TCEP]. The column was washed with 100 ml of SEC buffer before fractions were collected at 1.5 ml min−1 using an additional 180 ml. The peak fractions were collected and assessed for purity by SDS–PAGE on a 4–20% Protein Gel (Invitrogen) and visualized by Coomassie staining with InstantBlue colloidal stain (Expedeon, San Diego, California, USA). HpBPL eluted as a single, symmetrical, monodisperse peak accounting for >90% of the protein product at a molecular mass of ∼20 kDa, suggesting purification as a monomer (monomer expected molecular weight 25 kDa). The peak fraction was pooled and concentrated to ∼62.8 mg ml−1 using an Amicon purification system (Millipore). 110 µl aliquots were flash-frozen in liquid nitrogen and stored at −80°C until use. Recombinant HpBPL is available for request online at https://targetstatus.ssgcid.org/Target/HepyC.19466.

2.2. Crystallization

His-tagged HpBPL crystallized at 290 K using sitting-drop vapor diffusion directly from a JCSG+ screen condition (Table 2[link]). HpBPL at 62.8 mg ml−1 in SEC buffer was mixed with MgCl2, ATP and biotin, and the mixture was incubated at 25°C for 10 min to generate the protein–ligand mixture (23.6 mg ml−1 HpBPL with 6 mM MgCl2, 6 mM ATP and 6 mM biotin). 0.4 µl of the protein–ligand mixture was mixed with an equal volume of the precipitant solution in the well of a Rigaku Reagents XJR sitting-drop vapor-diffusion tray. 80 µl precipitant solution (JCSG+ condition B1; 0.1 M sodium citrate tribasic/citric acid pH 4.0, 0.8 M ammonium sulfate) was present in the reservoir (Table 2[link]). Before data collection, the crystals were harvested and cryoprotected with 25%(v/v) ethylene glycol (Table 2[link]).

Table 2
Crystallization

Method Vapor diffusion, sitting drop
Plate type Tray 101-d6, 96-well plates
Temperature (K) 290
Protein concentration (mg ml−1) 23.6
Ligand mixture composition 6 mM MgCl2, 6 mM ATP, 6 mM biotin
Buffer composition of protein solution 20 mM HEPES pH 7.0, 300 mM NaCl, 5%(v/v) glycerol, 1 mM TCEP
Composition of reservoir solution 0.1 M sodium citrate tribasic–citric acid pH 4.0, 0.8 M ammonium sulfate (JCSG+ condition B1)
Volume (µl) 0.4
Ratio of drop 1:1
Volume of reservoir (µl) 80
Composition of cryoprotectant solution 0.075 M sodium citrate tribasic–citric acid pH 4.0, 0.6 M ammonium sulfate, 25%(v/v) ethylene glycol

2.3. Data collection and processing

Diffraction data were collected at 100 K on Advanced Photon Source (APS) beamline 21-ID-F at Argonne National Laboratory (Table 3[link]). The data were integrated with XDS and reduced with XSCALE (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 133-144.]). Raw X-ray diffraction images were stored at the Integrated Resource for Reproducibility in Macromolecular Crystallo­graphy at https://www.proteindiffraction.org.

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source APS beamline 21-ID-F
Temperature (K) 100
Detector MAR Mosaic 300 mm CCD
Wavelength (Å) 0.97872
Detector distance (mm) 300
Oscillation angle (°) 1
Total No. of frames 360
α, β, γ (°) 122.1, 94.7, 107.9
Resolution range (Å) 47.95–2.25 (2.31–2.25)
Total No. of reflections 93167 (6432)
No. of unique reflections 23767 (1625)
Completeness (%) 97.1 (89.4)
Multiplicity 5.8 (6.2)
〈I/σ(I)〉 3.9 (4.0)
Rr.i.m. 0.055 (0.523)
CC1/2 (%) 99.9 (93.7)
Overall B factor from Wilson plot (Å2) 36.4

2.4. Structure solution and refinement

The structure of HpBPL was determined by molecular replacement using Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) from the CCP4 suite of programs (Collaborative Computational Project, Number 4, 1994[Collaborative Computational Project, Number 4 (1994). Acta Cryst. D50, 760-763.]; Krissinel et al., 2004[Krissinel, E. B., Winn, M. D., Ballard, C. C., Ashton, A. W., Patel, P., Potterton, E. A., McNicholas, S. J., Cowtan, K. D. & Emsley, P. (2004). Acta Cryst. D60, 2250-2255.]; Winn et al., 2011[Winn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235-242.]; Agirre et al., 2023[Agirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449-461.]) with PDB entry 3l1a (Gupta et al., 2010[Gupta, V., Gupta, R. K., Khare, G., Salunke, D. M., Surolia, A. & Tyagi, A. K. (2010). PLoS One, 5, e9222.]) as the search model. The structure was refined using Phenix (Liebschner et al., 2019[Liebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861-877.]). The omit Fo − Fc electron-density map for the biotinyl-5-ATP is well ordered (Fig. 1[link]a). The model was built into high-quality 2Fo − Fc electron density (Fig. 1[link]b). The structure quality was checked using MolProbity (Williams et al., 2018[Williams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, J. S. (2018). Protein Sci. 27, 293-315.]). Data-reduction and refinement statistics are shown in Table 4[link]. Coordinate and structure factors have been deposited in the Worldwide PDB (wwPDB) as entry 6ck0.

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 47.95–2.25 (2.31–2.25)
Completeness (%) 97.7 (89.4)
σ Cutoff F > 1.97σ(F)
No. of reflections, working set 23747 (1428)
No. of reflections, test set 1978 (132)
Final Rcryst 0.171 (0.370)
Final Rfree 0.221 (0.430)
No. of non-H atoms
 Protein 3229
 Ion 20
 Ligand 108
 Solvent 116
 Total 3473
R.m.s. deviations
 Bond lengths (Å) 0.003
 Angles (°) 0.502
Average B factors (Å2)
 Protein 41.9
 Ion 84.4
 Ligand 51.6
 Water 45.0
Ramachandran plot
 Most favored (%) 97
 Allowed (%) 2
 Outliers (%) 1
[Figure 1]
Figure 1
HpBPL electron-density maps. The biotinyl-5-ATP from (a) monomer A and (b) monomer B fits into initial 3σ omit (Fo − Fc) electron-density maps (green mesh). (c) The 1.2σ 2Fo − Fc electron-density map of HpBPL is shown as a blue mesh.

3. Results and discussion

Size-exclusion chromatography data suggest that HpBPL assembles as a monodisperse monomer in solution with a molecular weight of ∼20 kDa, close to the theoretical mass of 25 kDa. Analysis with the Protein Interfaces, Surfaces and Assembly (PISA) service at the European Bioinformatics Institute (https://www.ebi.ac.uk/pdbe/prot_int/pistart.html) agrees with the SEC data that HpBPL is indeed a biological monomer (Krissinel, 2015[Krissinel, E. (2015). Nucleic Acids Res. 43, W314-W319.]). Recombinant HpBPL is catalytically active and generates biotinyl-5-ATP upon incubation with MgCl2, ATP and biotin, which is observed in the active site (Fig. 1[link]).

The structure was refined in the triclinic space group P1 with two monomers in the asymmetric unit (Fig. 2[link]a). Both monomers are similar, with an r.m.s.d. of 0.20 Å for all Cα atoms (Fig. 2[link]b). Each monomer contains a biotinyl-5-ATP molecule in the central catalytic cavity (Figs. 1[link], 2[link] and 3[link]). Both monomers include the following secondary structures: 34.4% strands, 22.5% α-helix and 6.7% 310-helix. The 14 β-strands assemble as four β-sheets consisting of one seven-stranded mixed sheet, two two-stranded antiparallel sheets and a three-stranded antiparallel sheet (Fig. 2[link]c). HpBPL has eight helices, one β–α–β motif, four helix–helix interactions and 17 β-turns.

[Figure 2]
Figure 2
Overall structure of HpBPL. (a) HpBPL dimer. (b) Ribbon diagrams of superposed HpBPL monomers reveal conserved topology; one monomer is gray and the other is pink. (c) Cartoon of HpBPL colored in rainbow from blue at the N-terminus to red at the C-terminus.
[Figure 3]
Figure 3
(a) The solvent-accessible surface area of HpBPL is colored by sequence conservation, with red indicating identical residues. (b) Ribbon diagram calculated by ENDScript. The circumference of the ribbon (sausage) represents relative structural conservation compared with other BPL structures. Thinner ribbons represent more conserved regions. In comparison, thicker ribbons represent less conserved regions and the ribbon is colored by sequence conservation, with red indicating identical residues. (c) Alignment of HpBPL and MtBPL. The PDB entries of the protein structures used for this alignment are indicated in Supplementary Fig. S1.

ENDScript (Gouet et al., 2003[Gouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320-3323.]; Robert & Gouet, 2014[Robert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320-W324.]) analysis reveals that HpBPL has a prototypical bacterial biotin protein ligase topology (Supplementary Fig. S1). This is consistent with its InterPro classification as a member of the biotin–acetyl-CoA-carboxylase ligase (IPR004408) family and as a biotin protein ligase/lipoate protein ligase (BPL/LPL) catalytic domain-containing protein. Additionally, residues near biotinyl-5-ATP in the active sites of bacterial BPLs are well conserved, as indicated by the red color in the sausage and surface plots (Figs. 3[link]a and 3[link]b). Furthermore, the thinness of the sausage plot reveals the well conserved tertiary structure of biotinyl-5-ATP-binding regions among bacterial BPLs (Fig. 3[link]a).

PDBeFold (Krissinel & Henrick, 2004[Krissinel, E. & Henrick, K. (2004). Acta Cryst. D60, 2256-2268.]) analysis using the default threshold of 70% identified the nearest structural neighbor of HpBPL to be the structure of Mycobacterium tuberculosis biotin protein ligase (MtBPL) with a nucleoside-based bisubstrate adenylation inhibitor (PDB entry 4xu1; Bockman et al., 2015[Bockman, M. R., Kalinda, A. S., Petrelli, R., De la Mora-Rey, T., Tiwari, D., Liu, F., Dawadi, S., Nandakumar, M., Rhee, K. Y., Schnappinger, D., Finzel, B. C. & Aldrich, C. C. (2015). J. Med. Chem. 58, 7349-7369.]). Nucleoside-based bisubstrate adenylation inhibitors of MtBPL have been developed to block the catalytic activity of MtBPL (Bockman et al., 2015[Bockman, M. R., Kalinda, A. S., Petrelli, R., De la Mora-Rey, T., Tiwari, D., Liu, F., Dawadi, S., Nandakumar, M., Rhee, K. Y., Schnappinger, D., Finzel, B. C. & Aldrich, C. C. (2015). J. Med. Chem. 58, 7349-7369.]). MtBPL (PDB entry 4xu1) and HpBPL align well and share a well conserved core domain (Fig. 3[link]c). Additional results from PDBeFold are detailed in Supplementary Table S1. MtBPL shares less than 22% sequence identity with HpBPL and has been investigated for drug discovery (Duckworth et al., 2011[Duckworth, B. P., Geders, T. W., Tiwari, D., Boshoff, H. I., Sibbald, P. A., Barry, C. E. III, Schnappinger, D., Finzel, B. C. & Aldrich, C. C. (2011). Chem. Biol. 18, 1432-1441.]; Gupta et al., 2010[Gupta, V., Gupta, R. K., Khare, G., Salunke, D. M., Surolia, A. & Tyagi, A. K. (2010). PLoS One, 5, e9222.]; Ma et al., 2014[Ma, Q., Akhter, Y., Wilmanns, M. & Ehebauer, M. T. (2014). Protein Sci. 23, 932-939.]; Bockman et al., 2015[Bockman, M. R., Kalinda, A. S., Petrelli, R., De la Mora-Rey, T., Tiwari, D., Liu, F., Dawadi, S., Nandakumar, M., Rhee, K. Y., Schnappinger, D., Finzel, B. C. & Aldrich, C. C. (2015). J. Med. Chem. 58, 7349-7369.]). Structure-based sequence alignment reveals that MtBPL has a more extended N-terminus than HpBPL, while the core structures are well conserved (Fig. 4[link]). The catalytic lysine Lys110 in HpBPL is conserved and aligns well with its counterpart Lys138 in MtBPL (Figs. 4[link], 5[link] and 6[link]).

[Figure 4]
Figure 4
Structural and primary-sequence alignment of HpBPL (PDB entry 6ck0) and MtBPL (PDB entry 4xu1). The secondary-structure elements are as follows: α-helices are shown as large coils, 310-helices are shown as small coils labeled η, β-strands are shown as arrows labeled β and β-turns are labeled TT. The identical residues are shown on a red background, with conserved residues in red and conserved regions in blue boxes. Fig. 4[link] was generated using ESPript 3.0 (Gouet et al., 1999[Gouet, P., Courcelle, E., Stuart, D. I. & Métoz, F. (1999). Bioinformatics, 15, 305-308.], 2003[Gouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320-3323.]).
[Figure 5]
Figure 5
LigPlus-generated interaction plots show conserved catalytic cavity residues. Structures are shown of (a) HpBPL with biotinyl-5-ATP (PDB entry 6ck0), (b) HpBPL with biotinyl-5-ATP (PDB entry 6ck0) superposed with MtBPL with a nucleoside-based bisubstrate adenylation inhibitor (PDB entry 4xu1) and (c) MtBPL with a nucleoside-based bisubstrate adenylation inhibitor (PDB entry 4xu1).
[Figure 6]
Figure 6
Comparison of biotinyl-5-ATP binding and biotinyl-5-AMP binding by HpBPL (PDB entry 6ck0) and MtBPL (PDB entry 4op0).

Additionally, the active site of HpBPL aligns well with that of MtBPL and appears to be capable of binding the nucleoside-based bisubstrate adenylation inhibitor (Fig. 5[link]). There is no reported structure of MtBPL with biotinyl-5-ATP, but there is a reported structure with biotinyl-5-AMP (PDB entry 4op0). The active-site residues in the co-crystal structure of MtBPL with biotinyl-5-AMP are well conserved compared with HpBPL, as indicated by the circled conserved residues in a LigPlus-generated interaction (Fig. 6[link]). The pyrophosphate group from biotinyl-5-ATP in our HpBPL structure forms hydrogen bonds with the three catalytic site residues (Arg46, Lys99 and His182). Overall, HpBPL shares significant structural similarities with MtBPL, which is promising for repurposing MtBPL inhibitors. Future studies include a more detailed analysis of MtBPL inhibitors to select those that can be repurposed as HpBPL inhibitors.

4. Conclusion

The production, crystallization and 2.25 Å resolution structure of HpBPL reveal a well conserved catalytic cavity and structural similarity to MtBPL. Thus, nucleoside-based bisubstrate adenylation and other MtBPL inhibitors may be suitable starting points for HpBPL inhibitors.

Footnotes

‡Co-first authors.

Acknowledgements

This project is part of a continuing SSGCID collaboration training Dartmouth undergraduate students in structural science, rational structure-based drug discovery and scientific communication. We thank the Dartmouth Cancer Center Director, Dr Steven Leach, for his support.

Biographical information

[link]

[Scheme 1]
Early career authors: Jesuferanmi P. Ayanlade and Dylan E. Davis.

Funding information

This project has been funded in whole or in part with Federal funds from the National Institute of Allergy and Infectious Diseases, National Institutes of Health, Department of Health and Human Services under Contract No. 75N93022C00036. DED is funded by NCI (grant No. R25CA250956).

References

First citationAgirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449–461.  Web of Science CrossRef IUCr Journals Google Scholar
First citationAhn, H. J. & Lee, D. S. (2015). World J. Gastrointest. Oncol. 7, 455–465.  CrossRef PubMed Google Scholar
First citationBenoit, S. L., Maier, R. J., Sawers, R. G. & Greening, C. (2020). Microbiol. Mol. Biol. Rev. 84, e00092-19.  CrossRef CAS PubMed Google Scholar
First citationBockman, M. R., Kalinda, A. S., Petrelli, R., De la Mora-Rey, T., Tiwari, D., Liu, F., Dawadi, S., Nandakumar, M., Rhee, K. Y., Schnappinger, D., Finzel, B. C. & Aldrich, C. C. (2015). J. Med. Chem. 58, 7349–7369.  Web of Science CrossRef CAS PubMed Google Scholar
First citationBurns, B. P., Hazell, S. L. & Mendz, G. L. (1995). Microbiology, 141, 3113–3118.  CrossRef CAS PubMed Google Scholar
First citationCollaborative Computational Project, Number 4 (1994). Acta Cryst. D50, 760–763.  CrossRef Web of Science IUCr Journals Google Scholar
First citationCover, T. L. & Blaser, M. J. (2009). Gastroenterology, 136, 1863–1873.  CrossRef PubMed CAS Google Scholar
First citationDuckworth, B. P., Geders, T. W., Tiwari, D., Boshoff, H. I., Sibbald, P. A., Barry, C. E. III, Schnappinger, D., Finzel, B. C. & Aldrich, C. C. (2011). Chem. Biol. 18, 1432–1441.  CrossRef CAS PubMed Google Scholar
First citationElbehiry, A., Marzouk, E., Aldubaib, M., Abalkhail, A., Anagreyyah, S., Anajirih, N., Almuzaini, A. M., Rawway, M., Alfadhel, A., Draz, A. & Abu-Okail, A. (2023). Antibiotics, 12, 191.  CrossRef PubMed Google Scholar
First citationGouet, P., Courcelle, E., Stuart, D. I. & Métoz, F. (1999). Bioinformatics, 15, 305–308.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320–3323.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGupta, V., Gupta, R. K., Khare, G., Salunke, D. M., Surolia, A. & Tyagi, A. K. (2010). PLoS One, 5, e9222.  Web of Science CrossRef PubMed Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 133–144.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKrissinel, E. (2015). Nucleic Acids Res. 43, W314–W319.  Web of Science CrossRef CAS PubMed Google Scholar
First citationKrissinel, E. & Henrick, K. (2004). Acta Cryst. D60, 2256–2268.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKrissinel, E. B., Winn, M. D., Ballard, C. C., Ashton, A. W., Patel, P., Potterton, E. A., McNicholas, S. J., Cowtan, K. D. & Emsley, P. (2004). Acta Cryst. D60, 2250–2255.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKuhns, L. G., Benoit, S. L., Bayyareddy, K., Johnson, D., Orlando, R., Evans, A. L., Waldrop, G. L. & Maier, R. J. (2016). J. Bacteriol. 198, 1423–1428.  CrossRef CAS PubMed Google Scholar
First citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
First citationMa, Q., Akhter, Y., Wilmanns, M. & Ehebauer, M. T. (2014). Protein Sci. 23, 932–939.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMalfertheiner, P., Camargo, M. C., El-Omar, E., Liou, J. M., Peek, R., Schulz, C., Smith, S. I. & Suerbaum, S. (2023). Nat. Rev. Dis. Primers, 9, 19.  CrossRef PubMed Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMoss, S. F., Chey, W. D., Daniele, P., Pelletier, C., Jacob, R., Tremblay, G., Hubscher, E., Leifke, E. & Malfertheiner, P. (2023). Ther. Adv. Gastroenterol. 16, 17562848231167284.  CrossRef Google Scholar
First citationRobert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320–W324.  Web of Science CrossRef CAS PubMed Google Scholar
First citationRodríguez-Hernández, D., Vijayan, K., Zigweid, R., Fenwick, M. K., Sankaran, B., Roobsoong, W., Sattabongkot, J., Glennon, E. K. K., Myler, P. J., Sunnerhagen, P., Staker, B. L., Kaushansky, A. & Grøtli, M. (2023). Nat. Commun. 14, 5408.  Web of Science PubMed Google Scholar
First citationSerbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594–599.  Web of Science CrossRef IUCr Journals Google Scholar
First citationStacy, R., Begley, D. W., Phan, I., Staker, B. L., Van Voorhis, W. C., Varani, G., Buchko, G. W., Stewart, L. J. & Myler, P. J. (2011). Acta Cryst. F67, 979–984.  Web of Science CrossRef IUCr Journals Google Scholar
First citationStudier, F. W. (2005). Protein Expr. Purif. 41, 207–234.  Web of Science CrossRef PubMed CAS Google Scholar
First citationWarren, J. R. & Marshall, B. (1983). Lancet, 1, 1273–1275.  CAS PubMed Google Scholar
First citationWilliams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, J. S. (2018). Protein Sci. 27, 293–315.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWinn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds