research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

A two-in-one expression construct for biophysical and structural studies of the human pregnane X receptor ligand-binding domain, a pharmaceutical and environmental target

crossmark logo

aCentre de Biologie Structurale (CBS), Univ. Montpellier, INSERM, CNRS, Montpellier, France, and bIBMM, Univ. Montpellier, CNRS, ENSCM, Montpellier, France
*Correspondence e-mail: [email protected]

Edited by S. Sheriff, Bristol-Myers Squibb, USA (Received 4 October 2024; accepted 26 January 2025; online 9 February 2025)

The ligand-binding domain (LBD) of the human nuclear receptor pregnane X receptor (PXR) is known to crystallize in two different crystal forms, P212121 or P43212, depending on the construct and the strategy used for protein production, as well as the presence or absence of the coactivator-derived peptide SRC-1. In order to facilitate biophysical and structural studies, a versatile construct was designed that allows access to both forms. This was achieved by introducing a thrombin cleavage site between the PXRLBD and the SRC-1 peptide fused to its C-terminus. Here, we describe the expression, purification and crystallization processes of this novel construct and report two new structures of PXRLBD that were obtained thanks to this strategy.

1. Introduction

The human pregnane X receptor (PXR, NR1I2) is a transcription factor belonging to the nuclear receptor (NR) family. PXR has the classical modular structure of NRs, consisting mainly of an N-terminal DNA-binding domain (DBD) and a C-terminal ligand-binding domain (LBD) linked by a hinge region. The general molecular mechanism of NR is as follows: upon ligand binding, changes occur on the receptor surfaces, which represent interaction sites for a wide range of transcriptional coactivators and corepressors (for example the steroid receptor coactivator-1, SRC-1). To date, 66 structures of the PXRLBD have been reported, showing complexes with a diverse range of molecules including drugs (Schneider et al., 2022[Schneider, M., Delfosse, V., Gelin, M., Grimaldi, M., Granell, M., Heriaud, L., Pons, J. L., Cohen Gonsaud, M., Balaguer, P., Bourguet, W. & Labesse, G. (2022). J. Med. Chem. 65, 1552-1566.]; Chrencik et al., 2005[Chrencik, J. E., Orans, J., Moore, L. B., Xue, Y., Peng, L., Collins, J. L., Wisely, G. B., Lambert, M. H., Kliewer, S. A. & Redinbo, M. R. (2005). Mol. Endocrinol. 19, 1125-1134.]; Lin et al., 2023[Lin, W., Huber, A. D., Poudel, S., Li, Y., Seetharaman, J., Miller, D. J. & Chen, T. (2023). Proc. Natl Acad. Sci. USA, 120, e2217804120.]), environmental pollutants (Delfosse et al., 2015[Delfosse, V., Dendele, B., Huet, T., Grimaldi, M., Boulahtouf, A., Gerbal-Chaloin, S., Beucher, B., Roecklin, D., Muller, C., Rahmani, R., Cavaillès, V., Daujat-Chavanieu, M., Vivat, V., Pascussi, J. M., Balaguer, P. & Bourguet, W. (2015). Nat. Commun. 6, 8089.], 2021[Delfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.]) and natural compounds (Bartolini et al., 2020[Bartolini, D., De Franco, F., Torquato, P., Marinelli, R., Cerra, B., Ronchetti, R., Schon, A., Fallarino, F., De Luca, A., Bellezza, G., Ferri, I., Sidoni, A., Walton, W. G., Pellock, S. J., Redinbo, M. R., Mani, S., Pellicciari, R., Gioiello, A. & Galli, F. (2020). J. Med. Chem. 63, 3701-3712.]; Fan et al., 2023[Fan, S., Yan, Y., Xia, Y., Zhou, Z., Luo, L., Zhu, M., Han, Y., Yao, D., Zhang, L., Fang, M., Peng, L., Yu, J., Liu, Y., Gao, X., Guan, H., Li, H., Wang, C., Wu, X., Zhu, H., Cao, Y. & Huang, C. (2023). Nat. Commun. 14, 3368.]). Indeed, the PXRLBD contains a large and versatile ligand-binding pocket (LBP), which enables it to bind a range of molecules with different structures and chemical properties, thereby fulfilling its biological functions (Delfosse et al., 2021[Delfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.]; Hall et al., 2021[Hall, A., Chanteux, H., Ménochet, K., Ledecq, M. & Schulze, M. E. D. (2021). J. Med. Chem. 64, 6413-6522.]; Buchman et al., 2018[Buchman, C. D., Chai, S. C. & Chen, T. (2018). Expert Opin. Drug Metab. Toxicol. 14, 635-647.]). PXR is traditionally regarded as a xenobiotic receptor, and as such it regulates the transcription of metabolizing enzymes and drug transporters, thereby facilitating the removal of xenobiotics from the body (Gee et al., 2024[Gee, R. R. F., Huber, A. D. & Chen, T. (2024). Expert Opin. Drug Metab. Toxicol. 20, 9-23.]; Rakateli et al., 2023[Rakateli, L., Huchzermeier, R. & van der Vorst, E. P. C. (2023). Cells, 12, 2752.]; Willson & Kliewer, 2002[Willson, T. M. & Kliewer, S. A. (2002). Nat. Rev. Drug Discov. 1, 259-266.]). Consequently, PXR plays a role in the early stages of drug metabolism, which can result in adverse effects such as drug–drug interactions, resistance to anticancer therapies or the accumulation of toxic metabolites (Rao et al., 2023[Rao, Z.-Z., Tang, Z.-W. & Wen, J. (2023). World J. Clin. Oncol. 14, 335-342.]; Feng et al., 2018[Feng, F., Jiang, Q., Cao, S., Cao, Y., Li, R., Shen, L., Zhu, H., Wang, T., Sun, L., Liang, E., Sun, H., Chai, Y., Li, X., Liu, G., Yang, R., Yang, Z., Yang, Y., Xin, S. & Li, B. (2018). Biochim. Biophys. Acta, 1862, 1017-1030.]; Planque et al., 2016[Planque, C., Rajabi, F., Grillet, F., Finetti, P., Bertucci, F., Gironella, M., Lozano, J. J., Beucher, B., Giraud, J., Garambois, V., Vincent, C., Brown, D., Caillo, L., Kantar, J., Pelegrin, A., Prudhomme, M., Ripoche, J., Bourgaux, J. F., Ginestier, C., Castells, A., Hollande, F., Pannequin, J. & Pascussi, J. M. (2016). Oncotarget, 7, 56558-56573.]; Yu et al., 2022[Yu, J., Wang, Y. & Ragueneau-Majlessi, I. (2022). Clin. Ther. 44, 1536-1544.]). However, an increasing body of evidence shows that PXR has a broader range of actions, including roles in inflammatory processes and in regulating lipid and glucose metabolism (Rakateli et al., 2023[Rakateli, L., Huchzermeier, R. & van der Vorst, E. P. C. (2023). Cells, 12, 2752.]; Gee et al., 2024[Gee, R. R. F., Huber, A. D. & Chen, T. (2024). Expert Opin. Drug Metab. Toxicol. 20, 9-23.]; Lv et al., 2022[Lv, Y., Luo, Y.-Y., Ren, H.-W., Li, C.-J., Xiang, Z.-X. & Luan, Z.-L. (2022). Front. Endocrinol. 13, 959902.]; Wang et al., 2022[Wang, J., Lu, P. & Xie, W. (2022). Med. Rev. 2, 611-624.]; Bautista-Olivier & Elizondo, 2022[Bautista-Olivier, C. D. & Elizondo, G. (2022). Biochem. Pharmacol. 202, 115147.]). Therefore, this receptor is of great interest to the pharmaceutical industry, with the aim of enhancing the efficacy of specific drug treatments and developing novel therapies. Moreover, PXR constitutes a significant target for environmental compounds, making it a subject of interest for the chemical industry with regard to its environmental and public health relevance (Delfosse et al., 2015[Delfosse, V., Dendele, B., Huet, T., Grimaldi, M., Boulahtouf, A., Gerbal-Chaloin, S., Beucher, B., Roecklin, D., Muller, C., Rahmani, R., Cavaillès, V., Daujat-Chavanieu, M., Vivat, V., Pascussi, J. M., Balaguer, P. & Bourguet, W. (2015). Nat. Commun. 6, 8089.], 2021[Delfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.]; Toporova & Balaguer, 2020[Toporova, L. & Balaguer, P. (2020). Mol. Cell. Endocrinol. 502, 110665.]).

In the Protein Data Bank, crystal structures of the PXRLBD are mainly reported in two different crystal forms correlated with the construct used for protein production and crystallization (Table 1[link]). The first form has symmetry consistent with space group P212121, comprising two molecules per asymmetric unit. The LBD of PXR is crystallized in the presence of a peptide that mimics the SRC-1 coactivator. This peptide serves to enhance the stability of PXR throughout the production and purification processes. Two strategies have been established for the introduction of SRC-1. The first involves co-expressing the PXRLBD and a fragment of SRC-1 of about 80 residues (623–710), followed by the addition of an excess of a synthetic SRC-1 peptide (25 residues, 6 76–700) to ensure the stability of the complex during crystallization (Watkins, Maglich et al., 2003[Watkins, R. E., Maglich, J. M., Moore, L. B., Wisely, G. B., Noble, S. M., Davis-Searles, P. R., Lambert, M. H., Kliewer, S. A. & Redinbo, M. R. (2003). Biochemistry, 42, 1430-1438.]; Lin et al., 2017[Lin, W., Wang, Y. M., Chai, S. C., Lv, L., Zheng, J., Wu, J., Zhang, Q., Wang, Y. D., Griffin, P. R. & Chen, T. (2017). Nat. Commun. 8, 741.]). The second strategy involves fusing the PXRLBD to an SRC-1 peptide (23 residues, 678–700) at its C-terminus (Wang et al., 2008[Wang, W., Prosise, W. W., Chen, J., Taremi, S. S., Le, H. V., Madison, V., Cui, X., Thomas, A., Cheng, K. C. & Lesburg, C. A. (2008). Protein Eng. Des. Sel. 21, 425-433.]; Garcia-Maldonado et al., 2024[Garcia-Maldonado, E., Huber, A. D., Chai, S. C., Nithianantham, S., Li, Y., Wu, J., Poudel, S., Miller, D. J., Seetharaman, J. & Chen, T. (2024). Nat. Commun. 15, 4054.]). The second crystal form has the symmetry of space group P43212 and contains only one molecule per asymmetric unit. In this form, the PXRLBD crystallizes alone while the protein is co-expressed, as described previously with the SRC-1 fragment, which is partially lost during purification (Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]; Huber et al., 2023[Huber, A. D., Poudel, S., Li, Y., Lin, W., Wu, J., Miller, D. J. & Chen, T. (2023). Structure, 31, 1545-1555.]). During our structural studies, we used the co-expressed version for a long time to obtain crystals in space group P43212, but we were confronted with reproducibility problems in terms of purification yield (Delfosse et al., 2015[Delfosse, V., Dendele, B., Huet, T., Grimaldi, M., Boulahtouf, A., Gerbal-Chaloin, S., Beucher, B., Roecklin, D., Muller, C., Rahmani, R., Cavaillès, V., Daujat-Chavanieu, M., Vivat, V., Pascussi, J. M., Balaguer, P. & Bourguet, W. (2015). Nat. Commun. 6, 8089.], 2021[Delfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.]; Schneider et al., 2022[Schneider, M., Delfosse, V., Gelin, M., Grimaldi, M., Granell, M., Heriaud, L., Pons, J. L., Cohen Gonsaud, M., Balaguer, P., Bourguet, W. & Labesse, G. (2022). J. Med. Chem. 65, 1552-1566.]). We have also used a construct based on the so-called tethered PXRLBD-SRC-1, which allows easier purification and crystallizes in the P212121 crystal form, but this construct has the disadvantage of retaining SRC-1, which is not always necessary and may even prevent certain biophysical assays (for example receptor–coregulator interaction studies). To overcome this problem, we designed a new PXRLBD-Thb-SRC-1 fusion construct that combines the advantage of having good stability and solubility during purification with the possibility of crystallizing the PXRLBD with or without SRC-1 thanks to the introduction of a thrombin cleavage site between the PXRLBD and SRC-1 parts. This construct was used to crystallize the PXRLBD in both crystal forms with its reference ligand SR12813, as well as with two new ligands in the P43212 form. The protocols for the purification and crystallization of these four structures are reported here.

Table 1
PXRLBD structures by crystal form

PXRLBD-SRC-1 (P212121) 1nrl (Watkins, Davis-Searles et al., 2003[Watkins, R. E., Davis-Searles, P. R., Lambert, M. H. & Redinbo, M. R. (2003). J. Mol. Biol. 331, 815-828.]); 2o91 (Xue et al., 2007[Xue, Y., Chao, E., Zuercher, W. J., Willson, T. M., Collins, J. L. & Redinbo, M. R. (2007). Bioorg. Med. Chem. 15, 2156-2166.]); 3ctb, 3hvl (Wang et al., 2008[Wang, W., Prosise, W. W., Chen, J., Taremi, S. S., Le, H. V., Madison, V., Cui, X., Thomas, A., Cheng, K. C. & Lesburg, C. A. (2008). Protein Eng. Des. Sel. 21, 425-433.]); 5a86 (Hennessy et al., 2015[Hennessy, E. J., Oza, V., Adam, A., Byth, K., Castriotta, L., Grewal, G., Hamilton, G. A., Kamhi, V. M., Lewis, P., Li, D., Lyne, P., Öster, L., Rooney, M. T., Saeh, J. C., Sha, L., Su, Q., Wen, S., Xue, Y. & Yang, B. (2015). J. Med. Chem. 58, 7057-7075.]); 5x0r (Lin et al., 2017[Lin, W., Wang, Y. M., Chai, S. C., Lv, L., Zheng, J., Wu, J., Zhang, Q., Wang, Y. D., Griffin, P. R. & Chen, T. (2017). Nat. Commun. 8, 741.]); 6bns (Gong et al., 2018[Gong, H., Weinstein, D. S., Lu, Z., Duan, J. J., Stachura, S., Haque, L., Karmakar, A., Hemagiri, H., Raut, D. K., Gupta, A. K., Khan, J., Camac, D., Sack, J. S., Pudzianowski, A., Wu, D. R., Yarde, M., Shen, D. R., Borowski, V., Xie, J. H., Sun, H., D'Arienzo, C., Dabros, M., Galella, M. A., Wang, F., Weigelt, C. A., Zhao, Q., Foster, W., Somerville, J. E., Salter-Cid, L. M., Barrish, J. C., Carter, P. H. & Dhar, T. G. M. (2018). Bioorg. Med. Chem. Lett. 28, 85-93.]); 6dup (Vaz et al., 2018[Vaz, R. J., Li, Y., Chellaraj, V., Reiling, S., Kuntzweiler, T., Yang, D., Shen, H., Batchelor, J. D., Zhang, Y., Chen, X., McLean, L. R. & Kosley, R. (2018). Bioorg. Med. Chem. Lett. 28, 3194-3196.]); 6s41 (Focken et al., 2019[Focken, T., Burford, K., Grimwood, M. E., Zenova, A., Andrez, J. C., Gong, W., Wilson, M., Taron, M., Decker, S., Lofstrand, V., Chowdhury, S., Shuart, N., Lin, S., Goodchild, S. J., Young, C., Soriano, M., Tari, P. K., Waldbrook, M., Nelkenbrecher, K., Kwan, R., Lindgren, A., de Boer, G., Lee, S., Sojo, L., DeVita, R. J., Cohen, C. J., Wesolowski, S. S., Johnson, J. P., Dehnhardt, C. M. & Empfield, J. R. (2019). J. Med. Chem. 62, 9618-9641.]); 6hty (Werner et al., 2019[Werner, S., Mesch, S., Hillig, R. C., ter Laak, A., Klint, J., Neagoe, I., Laux-Biehlmann, A., Dahllöf, H., Bräuer, N., Puetter, V., Nubbemeyer, R., Schulz, S., Bairlein, M., Zollner, T. M. & Steinmeyer, A. (2019). J. Med. Chem. 62, 11194-11217.]); 6nx1 (Duan et al., 2019[Duan, J. J., Lu, Z., Jiang, B., Stachura, S., Weigelt, C. A., Sack, J. S., Khan, J., Ruzanov, M., Galella, M. A., Wu, D. R., Yarde, M., Shen, D. R., Shuster, D. J., Borowski, V., Xie, J. H., Zhang, L., Vanteru, S., Gupta, A. K., Mathur, A., Zhao, Q., Foster, W., Salter-Cid, L. M., Carter, P. H. & Dhar, T. G. M. (2019). ACS Med. Chem. Lett. 10, 367-373.]); 6p2b (Bartolini et al., 2020[Bartolini, D., De Franco, F., Torquato, P., Marinelli, R., Cerra, B., Ronchetti, R., Schon, A., Fallarino, F., De Luca, A., Bellezza, G., Ferri, I., Sidoni, A., Walton, W. G., Pellock, S. J., Redinbo, M. R., Mani, S., Pellicciari, R., Gioiello, A. & Galli, F. (2020). J. Med. Chem. 63, 3701-3712.]); 6xp9 (Sivaprakasam et al., 2020[Sivaprakasam, P., Wang, Z., Meanwell, N. A., Khan, J. A., Langley, D. R., Johnson, S. R., Li, G., Pendri, A., Connolly, T. P., Gao, M., Camac, D. M., Klakouski, C., Zvyaga, T., Cianci, C., McAuliffe, B., Ding, B., Discotto, L., Krystal, M. R., Jenkins, S., Peese, K. M. & Narasimhulu Naidu, B. (2020). Bioorg. Med. Chem. Lett. 30, 127531.]); 6tfi (Hillisch et al., 2020[Hillisch, A., Gericke, K. M., Allerheiligen, S., Roehrig, S., Schaefer, M., Tersteegen, A., Schulz, S., Lienau, P., Gnoth, M., Puetter, V., Hillig, R. C. & Heitmeier, S. (2020). J. Med. Chem. 63, 12574-12594.]); 8eqz (Lin et al., 2023[Lin, W., Huber, A. D., Poudel, S., Li, Y., Seetharaman, J., Miller, D. J. & Chen, T. (2023). Proc. Natl Acad. Sci. USA, 120, e2217804120.]); 7yfk (Fan et al., 2023[Fan, S., Yan, Y., Xia, Y., Zhou, Z., Luo, L., Zhu, M., Han, Y., Yao, D., Zhang, L., Fang, M., Peng, L., Yu, J., Liu, Y., Gao, X., Guan, H., Li, H., Wang, C., Wu, X., Zhu, H., Cao, Y. & Huang, C. (2023). Nat. Commun. 14, 3368.]); 8f5y (Huber et al., 2024[Huber, A. D., Poudel, S., Wu, J., Miller, D. J., Lin, W., Yang, L., Bwayi, M. N., Rimmer, M. A., Gee, R. R. F., Seetharaman, J., Chai, S. C. & Chen, T. (2024). Nucleic Acids Res. 52, 1661-1676.]); 8svn, 8svo, 8svp, 8svq, 8svr, 8svs, 8svt, 8svu, 8svx (Garcia-Maldonado et al., 2024[Garcia-Maldonado, E., Huber, A. D., Chai, S. C., Nithianantham, S., Li, Y., Wu, J., Poudel, S., Miller, D. J., Seetharaman, J. & Chen, T. (2024). Nat. Commun. 15, 4054.])
PXRLBD (P43212) 1ilg, 1ilh (Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]); 1m13 (Watkins, Maglich et al., 2003[Watkins, R. E., Maglich, J. M., Moore, L. B., Wisely, G. B., Noble, S. M., Davis-Searles, P. R., Lambert, M. H., Kliewer, S. A. & Redinbo, M. R. (2003). Biochemistry, 42, 1430-1438.]); 1skx (Chrencik et al., 2005[Chrencik, J. E., Orans, J., Moore, L. B., Xue, Y., Peng, L., Collins, J. L., Wisely, G. B., Lambert, M. H., Kliewer, S. A. & Redinbo, M. R. (2005). Mol. Endocrinol. 19, 1125-1134.]); 2qnv (D. G. Teotico, J. Bischof & M. R. Redinbo, unpublished work); 3r8d (Cheng & Redinbo, 2011[Cheng, Y. & Redinbo, M. R. (2011). Protein Sci. 20, 1713-1719.]); 4ny9 (Santella et al., 2014[Santella, J. B., Gardner, D. S., Duncia, J. V., Wu, H., Dhar, M., Cavallaro, C., Tebben, A. J., Carter, P. H., Barrish, J. C., Yarde, M., Briceno, S. W., Cvijic, M. E., Grafstrom, R. R., Liu, R., Patel, S. R., Watson, A. J., Yang, G., Rose, A. V., Vickery, R. D., Caceres-Cortes, J., Caporuscio, C., Camac, D. M., Khan, J. A., An, Y., Foster, W. R., Davies, P. & Hynes, J. (2014). J. Med. Chem. 57, 7550-7564.]); 4xhd (Khan et al., 2015[Khan, J. A., Camac, D. M., Low, S., Tebben, A. J., Wensel, D. L., Wright, M. C., Su, J., Jenny, V., Gupta, R. D., Ruzanov, M., Russo, K. A., Bell, A., An, Y., Bryson, J. W., Gao, M., Gambhire, P., Baldwin, E. T., Gardner, D., Cavallaro, C. L., Duncia, J. V. & Hynes, J. (2015). J. Mol. Biol. 427, 924-942.]); 4x1f, 4x1g, 4xao (Delfosse et al., 2015[Delfosse, V., Dendele, B., Huet, T., Grimaldi, M., Boulahtouf, A., Gerbal-Chaloin, S., Beucher, B., Roecklin, D., Muller, C., Rahmani, R., Cavaillès, V., Daujat-Chavanieu, M., Vivat, V., Pascussi, J. M., Balaguer, P. & Bourguet, W. (2015). Nat. Commun. 6, 8089.]); 6hj2 (Schneider et al., 2022[Schneider, M., Delfosse, V., Gelin, M., Grimaldi, M., Granell, M., Heriaud, L., Pons, J. L., Cohen Gonsaud, M., Balaguer, P., Bourguet, W. & Labesse, G. (2022). J. Med. Chem. 65, 1552-1566.]); 7ax8, 7ax9, 7axa, 7axb, 7axc, 7axd, 7axe, 7axf, 7axg, 7axh, 7axi, 7axj, 7axk, 7axl (Delfosse et al., 2021[Delfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.]); 7n2a, 7rio, 7riu, 7riv (Ramanjulu et al., 2021[Ramanjulu, J. M., Williams, S. P., Lakdawala, A. S., DeMartino, M. P., Lan, Y. & Marquis, R. W. (2021). ACS Med. Chem. Lett. 12, 1396-1404.]); 8e3n, 8fpe (Lin et al., 2023[Lin, W., Huber, A. D., Poudel, S., Li, Y., Seetharaman, J., Miller, D. J. & Chen, T. (2023). Proc. Natl Acad. Sci. USA, 120, e2217804120.]); 8szv (Huber et al., 2023[Huber, A. D., Poudel, S., Li, Y., Lin, W., Wu, J., Miller, D. J. & Chen, T. (2023). Structure, 31, 1545-1555.]); 8cct, 8cf9, 8ch8 (C. Carivenc, Q. Derosa, M. Grimaldi, A. Boulahtouf, P. Balaguer & W. Bourguet, unpublished work)

2. Materials and methods

2.1. Protein production and purification

2.1.1. Cloning

We designed a DNA fragment containing the coding region for the PXRLBD (residues 130–434, UniProt entry O75469) fused, in its C-terminal part, to the coding region for the SRC-1 NR box II (residues 678–700, UniProt entry Q15788). In the hinge sequence located between the PXRLBD and the SRC-1, we inserted a sequence coding for a thrombin cleavage site (LVPR/GS; Fig. 1[link]a; Table 2[link]). In addition, the 5′ and 3′ extremities contained 15 base pairs required for In-Fusion cloning (Clontech), including the restriction sites NdeI and HindIII, respectively. The chimeric sequence was synthesized and cloned into the pET-11a expression vector (Novagen) by following the instructions for the In-Fusion cloning protocol in such a way that the final construct contains an N-terminal His6 tag (see the supporting information). The construct was sequenced to confirm that no mutations had occurred during the cloning procedures. The resulting protein will subsequently be referred to as PXRLBD-Thb-SRC-1.

Table 2
Macromolecule-production information

Source organism Homo sapiens
DNA source Synthetic gene (IDT)
Expression vector pET-11a
Plasmid construction method In-Fusion cloning (Clontech)
Expression host Escherichia coli BL21(DE3)
Expression details Autoinduction medium (see the supporting information for details)
Complete amino-acid sequence of the protein produced (PXRLBD-Thb-SRC-1)† MKKGHHHHHHGSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGSLVPRGSSSHSSLTERHKILHRLLQEGSPS
Amino-acid sequence of the protein after thrombin cleavage (PXRLBD)† MKKGHHHHHHGSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGSLVPR
†HHHHHH, His6 tag; LVPRGS, thrombin cleavage site.
[Figure 1]
Figure 1
A two-in-one construct that provides a large quantity of pure PXRLBD with or without SRC-1. (a) Schematic representation of the primary sequence of the cleavable PXRLBD-Thb-SRC-1 construct. (b) Gel-filtration elution profiles for the PXRLBD-Thb-SRC-1 (solid line) and PXRLBD (dashed line) proteins. The SDS–PAGE inset shows the PXRLBD samples before (lane nc) and after (lane c) thrombin cleavage. The ladder is labelled in kDa. (c) Thermal unfolding profiles of the PXRLBD-Thb-SRC-1 (solid line) and PXRLBD (dashed line) proteins before freezing (black) and after thawing (gray). For the latter, results are shown for samples that were thawed 18 months after purification.
2.1.2. Production

The plasmid was transformed into an Escherichia coli BL21(DE3) expression cell line and selected using ampicillin. Three colonies were used to inoculate a 500 ml flask containing 200 ml LB broth supplemented with 100 µg ml−1 ampicillin. The culture was grown overnight at 37°C. This preculture was used to inoculate two 2 l flasks containing 500 ml ZYM medium supplemented with 100 µg ml−1 ampicillin at an OD600 of 0.15 (see the supporting information). The culture was incubated for 4 h at 37°C and then overnight at 25°C. The cells were harvested by centrifugation at 6000g for 20 min. The resulting pellets were collected and stored at −40°C.

2.1.3. Purification

All steps were performed at 4°C, and aliquots were collected during the process to control for the presence and the purity of the proteins by SDS–PAGE. The pellets resulting from 2 × 500 ml culture were thawed on ice and homogenized using an Ultra-Turrax T-25 in 200 ml lysis buffer (20 mM Tris–HCl, 150 mM NaCl, 5% glycerol pH 8.0 at 4°C) supplemented with 200 µl of a 10 mg ml−1 lysozyme solution and two protease-inhibitor cocktail tablets (Complete EDTA-free, Roche). After 20 min of gentle stirring, the lysate was further processed by sonication with a Sonic Ruptor 4000 (power 40%, pulser 50%, 4 × 2 min) and then centrifugated for 30 min at 18 000g. The supernatant was manually and sequentially filtered using 5 and 0.45 µm filters. The following steps were performed with the help of an ÄKTApure system (Cytiva) located in a cold room. The cleared lysate was loaded onto a 5 ml Ni–NTA Superflow Cartridge (Qiagen) equilibrated with lysis buffer supplemented with 20 mM imidazole, i.e. 4% elution buffer (20 mM Tris–HCl, 150 mM NaCl, 500 mM imidazole, 5% glycerol, pH 8.0 at 4°C) at a flow rate of 1.5 ml min−1. In order to eliminate nonspecifically bound proteins, the column was washed with 30 column volumes (CV) of 4% elution buffer (final concentration of 20 mM imidazole) and then with 10 CV of 10% elution buffer (final concentration of 50 mM imidazole) at a flow rate of 3 ml min−1. The PXRLBD-Thb-SRC-1 fusion protein was eluted with 5 CV of 35% elution buffer (final concentration of 175 mM imidazole) at a flow rate of 3 ml min−1. The column was further washed with 10 CV of 100% elution buffer (final concentration of 500 mM imidazole) (Supplementary Fig. S1a). Following the affinity-chromatography step, the pooled PXRLBD-Thb-SRC-1-containing fractions were treated differently depending on whether or not it was desired to retain the SRC-1 peptide. In the first case, the eluted protein was concentrated with an Amicon Ultra-15 concentrator device (molecular-weight cutoff of 10 000, Millipore; several 15 min rounds of centrifugation at 3500g at 4°C) to reach a final volume of about 1.5 ml. The concentrated PXRLBD-Thb-SRC-1 sample was then centrifugated for 10 min at 10 000g to remove potential precipitates and applied onto a HiLoad 16/60 Superdex 75 prep-grade gel-filtration column (Cytiva) equilibrated with protein storage buffer (20 mM Tris–HCl, 250 mM NaCl, 1 mM DTT, 5% glycerol, pH 8.0 adjusted at 4°C). The PXRLBD-Thb-SRC-1-containing fractions (Fig. 1[link]b and Supplementary Fig. S1b) were pooled and concentrated to 10 mg ml−1 before crystallization experiments or storage at −40 or −80°C. In the case in which removal of the SRC-1 peptide was desired, it was cleaved with thrombin. The protein eluted from the nickel-affinity column was concentrated with an Amicon Ultra-15 concentrator device (molecular-weight cutoff of 10 000, Millipore; several 15 min rounds of centrifugation at 3500g at 4°C) to reach a final concentration of about 2–3 mg ml−1. Thrombin (catalogue No. T7513, Sigma–Aldrich) was added to one unit per milligram of PXRLBD-Thb-SRC-1 (i.e. 0.5 µg per milligram of PXRLBD-Thb-SRC-1) and the sample was then dialyzed overnight against 1 l protein storage buffer at 4°C. The cleaved PXRLBD was further concentrated to reach a final volume of about 1.5 ml, centrifugated for 10 min at 10 000g to remove potential precipitates and then applied onto a HiLoad 16/60 Superdex 75 prep-grade gel-filtration column (Cytiva) equilibrated with protein storage buffer (20 mM Tris–HCl, 250 mM NaCl, 1 mM DTT, 5% glycerol, pH 8.0 adjusted at 4°C). The PXRLBD-containing fractions (Fig. 1b and Supplementary Fig. S1b) were pooled and concentrated to 4 mg ml−1 before crystallization experiments or storage at −40 or −80°C.

2.2. Thermal denaturation

To ensure the quality of the protein samples and the consistency of the purification batches, the melting temperature was systematically controlled after purification and before crystallization trials using nano-differential scanning fluorimetry (nanoDSF). 10 µl of PXRLBD or PXRLBD-Thb-SRC-1 at 1 mg ml−1 was run on a Tycho NT.6 system in Tycho capillaries (NanoTemper Technologies; Fig. 1[link]c). Samples were heated progressively from 35 to 95°C at a defined rate of 30°C min−1 and intrinsic protein fluorescence from tryptophan and tyrosine residues was recorded at 330 and 350 nm throughout the run. The data were automatically analyzed by the system software to calculate the inflection temperature (Tm), which indicates the temperature at which the proteins unfold.

2.3. Crystallization

Crystals of the SR12813–PXRLBD-Thb-SRC-1 complex were obtained by co-crystallization (Table 3[link]; Fig. 2[link]a). Co-crystals of PXRLBD in complex with SR12813, JMV6995 or JMV7035 were obtained similarly (Table 3[link]; Fig. 2[link]b). Crystallization conditions were designed based on the literature. Ligands were stored and used in 100% DMSO at 10 mM. Crystals appeared in 24–72 h and, to avoid difficulties due to the formation of a skin around the crystallization drop, we harvested and flash-cooled the crystals within three days. No cryoprotectant was needed due to the presence of alcohols in the crystallization buffers.

Table 3
Crystallization conditions

  PXRLBD-Thb-SRC-1 (P212121) PXRLBD (P43212)
Method Hanging-drop vapor diffusion (manual) Hanging-drop vapor diffusion (manual)
Plate type EasyXtal 15-Well Tool + EasyXtal DropGuard Supports (Molecular Dimensions) EasyXtal 15-Well Tool + EasyXtal DropGuard Supports (Molecular Dimensions)
Temperature (K) 277 293
Protein concentration (mg ml−1/µM) 9–11/228–280 3–5/82–137
Protein buffer 50 mM Tris pH 8.0, 250 mM NaCl, 5%(v/v) glycerol, 1 mM DTT 50 mM Tris pH 8.0, 250 mM NaCl, 5%(v/v) glycerol, 1 mM DTT
Compound concentration Threefold molar excess of protein Threefold molar excess of protein
Protein–ligand incubation time 1 h at 4°C 1 h at 4°C
Reservoir solution 100 mM imidazole pH 7.0–7.4, 25–30%(v/v) MPD 75 mM imidazole pH 7.0–7.4, 8–14%(v/v) 2-propanol
Volume and ratio of drop 1 µl + 1 µl 1 µl + 1 µl
Volume of reservoir (µl) 500 500
[Figure 2]
Figure 2
Two crystal forms, two morphologies. (a) Crystal of PXRLBD-Thb-SRC-1 grown at 4°C in space group P212121. (b) Crystal of PXRLBD grown at 20°C in space group P43212.

2.4. Structure determination

2.4.1. Data collection and processing

Data were processed and scaled with XDS and XSCALE (Kabsch, 2010a[Kabsch, W. (2010a). Acta Cryst. D66, 125-132.],b[Kabsch, W. (2010b). Acta Cryst. D66, 133-144.]). Data-collection and processing statistics are reported in Table 4[link].

Table 4
Data-collection and processing statistics

Values in parentheses are for the highest resolution shell.

Protein PXRLBD-Thb-SRC-1 PXRLBD PXRLBD PXRLBD
Ligand SR12813 SR12813 JMV6995 JMV7035
PDB code 9fzi 9fzj 9fzh 9fzg
Diffraction source ID30A-3, ESRF ID30A-1, ESRF ID30A-1, ESRF ID29, ESRF
Wavelength (Å) 0.9677 0.9660 0.9660 0.9793
Temperature (K) 100 100 100 100
Detector EIGER 4M PILATUS3 2M PILATUS3 2M PILATUS 6M-F
Distance to detector (mm) 181.09 234.93 236.32 356.64
Total rotation range (°) 180 180 113 125
Rotation per image (°) 0.15 0.20 0.10 0.10
Exposure time per image (s) 0.005 0.100 0.116 0.037
Space group P212121 P43212 P43212 P43212
a, b, c (Å) 85.42, 89.03, 106.66 91.52, 91.52, 85.70 90.77, 90.77, 87.33 91.04, 91.04, 86.60
α, β, γ (°) 90.00, 90.00, 90.00 90.00, 90.00, 90.00 90.00, 90.00, 90.00 90.00, 90.00, 90.00
Mosaicity (°) 0.20 0.07 0.35 0.14
Resolution (Å) 44.51–2.70 (2.77–2.70) 40.37–1.60 (1.64–1.60) 40.27–2.50 (2.56–2.50) 40.71–2.00 (2.05–2.00)
Total No. of reflections 156162 (12160) 541498 (15290) 114522 (9478) 223611 (16036)
No. of unique reflections 22826 (1689) 48371 (3369) 15251 (1110) 25135 (1814)
Completeness (%) 99.3 (99.8) 99.6 (95.7) 96.4 (100.0) 99.8 (99.9)
Multiplicity 6.8 (7.2) 11.2 (4.5) 7.3 (8.4) 8.9 (8.8)
Mean I/σ(I) 11.98 (2.70) 32.9 (2.9) 27.1 (4.9) 28.9 (4.6)
Rmeas 0.103 (0.581) 0.036 (0.498) 0.051 (0.303) 0.046 (0.534)
CC1/2 (%) 99.8 (85.1) 100.0 (83.5) 99.9 (97.0) 100.0 (92.7)
Wilson B factor (Å2) 56 25 43 33
2.4.2. Structure solution and refinement

The structures were determined by molecular replacement (using PDB entry 1ilg as a search model; Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]) using Phenix (Liebschner et al., 2019[Liebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861-877.]) and refined using Phenix and Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). Refinement statistics are summarized in Table 5[link]. Figures were prepared with PyMOL (https://pymol.org/).

Table 5
Refinement statistics

Values in parentheses are for the highest resolution shell.

Protein PXRLBD-Thb-SRC-1 PXRLBD PXRLBD PXRLBD
Ligand SR12813 SR12813 JMV6995 JMV7035
PDB entry 9fzi 9fzj 9fzh 9fzg
Resolution (Å) 44.51–2.70 (2.82–2.70) 40.37–1.60 (1.63–1.60) 40.27–2.50 (2.69–2.50) 40.71–2.00 (2.08–2.00)
No. of reflections 22821 (2820) 48366 (2685) 12658 (2476) 25129 (2729)
Rwork/Rfree 0.194/0.237 (0.264/0.318) 0.182/0.208 (0.289/0.353) 0.216/0.256 (0.262/0.354) 0.191/0.237 (0.238/0.286)
No. of non-H atoms
 All 4610 2641 2128 2339
 Protein 4501 2295 2029 2060
 Ligand 66 51 50 80
 Water 43 295 49 199
B factors (Å2)
 Overall 54 32 46 38
 Protein 54 31 46 36
 Ligand 55 37 52 48
 Water 47 43 43 45
R.m.s. deviations
 Bond lengths (Å) 0.009 0.006 0.009 0.008
 Bond angles (°) 1.096 0.844 1.086 0.960
Ramachandran plot†
 Favored regions (%) 96.78 98.17 98.04 98.81
 Outliers (%) 0 0 0 0
†Calculated with MolProbity (Williams et al., 2018[Williams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, D. C. (2018). Protein Sci. 27, 293-315.]).

3. Results and discussion

The first structures of the PXRLBD were elucidated by the group of M. R. Redinbo in 2001 in the apo form and in complex with the pharmaceutical compound SR12813, and without the SRC-1 coactivator peptide (Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]). Currently, approximately 60 additional structures have been reported, and the PXRLBD remains a subject of interest in the fields of drug design and environmental science. These structures were obtained from crystals with the symmetry of space groups P212121 or P43212 depending on the presence or absence of the SRC-1 peptide, respectively. In both cases, the PXRLBD is produced and purified in the presence of an SRC-1 peptide, which ensures its solubility and stability. The peptide was initially introduced into the cultures of the PXRLBD via a co-expression system comprising two plasmids (Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]). Two alternative strategies have since emerged that facilitate the production of the PXRLBD: (i) the so-called `tethered construct', resulting in a PXRLBD-SRC-1 fusion protein (Wang et al., 2008[Wang, W., Prosise, W. W., Chen, J., Taremi, S. S., Le, H. V., Madison, V., Cui, X., Thomas, A., Cheng, K. C. & Lesburg, C. A. (2008). Protein Eng. Des. Sel. 21, 425-433.]), and (ii) the `Duet construct', which avoids modification of the PXRLBD by using a dual promoter expression vector (Lin et al., 2023[Lin, W., Huber, A. D., Poudel, S., Li, Y., Seetharaman, J., Miller, D. J. & Chen, T. (2023). Proc. Natl Acad. Sci. USA, 120, e2217804120.]). Although both methods guarantee equimolarity during production, the second method presents the disadvantage of requiring the addition of a synthetic peptide during the purification process to keep the protein stable. As part of our structural studies, we initially used the co-expression system kindly provided by M. R. Redinbo without incorporating a synthetic peptide throughout the purification and crystallization processes. Our objective was to examine the binding mode of environmental ligands on the PXRLBD without the SRC-1 peptide that reinforces the active conformation. This approach ensured that the orientation of the ligands and the conformation of the protein were not biased by this factor. The difficulties encountered in obtaining a sufficient quantity of pure protein in a reproducible manner for use in crystallization trials prompted us to redesign the tethered construct. The novelty of this construct lies in the presence of a thrombin cleavage site in the junction region between the PXRLBD and SRC-1 parts (Fig. 1[link]a), where the –GGSGG– sequence has been replaced by –LVPRGS–. This simple construct ensures the equimolar presence of the coactivator, which is required for better solubilization and stabilization of the PXRLBD throughout the production and purification process, without adding a synthetic peptide. It also allows removal of SRC-1 at the final step, when the protein is nearly pure and less prone to precipitation. Thus, by overproducing the protein in ZYM medium, we can obtain ∼10 mg of pure PXRLBD or ∼30 mg of pure PXRLBD-Thb-SRC-1 per litre of culture, respectively, which are stable over time when frozen (Figs. 1[link]b and 1[link]c). The difference in purification yield between the two forms is directly linked to the intrinsic stability of the LBD and has previously been reported (Wang et al., 2008[Wang, W., Prosise, W. W., Chen, J., Taremi, S. S., Le, H. V., Madison, V., Cui, X., Thomas, A., Cheng, K. C. & Lesburg, C. A. (2008). Protein Eng. Des. Sel. 21, 425-433.]). The SRC-1 peptide allows stabilization of the PXRLBD, thus facilitating its concentration during the different stages of purification. Precipitates were observed during the concentration of the PXRLBD before and after the gel-filtration step, which explains the lower yield obtained for this form. This behavior of the proteins is confirmed by their respective melting temperatures, which differ by about 8°C: 51–52°C for the PXRLBD and 59–60°C for the PXRLBD-Thb-SRC-1 (Fig. 1[link]c).

In order to assess the usefulness of the new construct and to verify that the new linker does not affect the process of crystallization, we determined the structure of the PXRLBD in complex with the reference ligand SR12813 with and without the SRC-1 peptide. The two forms were crystallized under the respective conditions and in the space groups (Table 3[link]) previously described in the literature. The crystals of the SR12813–PXRLBD-Thb-SRC-1 complex, which have the symmetry of space group P212121 with two molecules per asymmetric unit, were grown at 4°C in MPD, whereas those of the SR12813–PXRLBD complex have the symmetry of space group P43212, with one molecule per asymmetric unit, and were obtained at room temperature in 2-propanol. The structures were determined by molecular replacement using the apo form of the PXRLBD as a search model (PDB entry 1ilg; Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]). As expected, the SR12813–PXRLBD-Thb-SRC-1 complex structure is very similar to the structure of the tethered version (PDB entry 3hvl; Wang et al., 2008[Wang, W., Prosise, W. W., Chen, J., Taremi, S. S., Le, H. V., Madison, V., Cui, X., Thomas, A., Cheng, K. C. & Lesburg, C. A. (2008). Protein Eng. Des. Sel. 21, 425-433.]), with an r.s.m.d. of 0.9 Å over 275 matching Cα atoms (LSQ calculation). As observed in the initial structure (Wang et al., 2008[Wang, W., Prosise, W. W., Chen, J., Taremi, S. S., Le, H. V., Madison, V., Cui, X., Thomas, A., Cheng, K. C. & Lesburg, C. A. (2008). Protein Eng. Des. Sel. 21, 425-433.]), the linker between the PXRLBD and the SRC-1 parts, which is probably disordered, is not visible (Fig. 3[link]a). Only the SRC-1 peptide region interacting with the PXRLBD is well defined. Similarly, the region preceding H2′ (more or less including residues 176–209), which is absent in all of the PXRLBD and PXRLBD-SRC-1 structures listed in Table 1[link], is no more clearly defined in the new model (Fig. 3[link]a). A closer examination of the LBP revealed that the SR12813 ligand maintains its original orientation and specifically interacts with the protein as described previously. These interactions involve the formation of hydrogen bonds to the side chains of residues Ser247 and His407 (Fig. 3[link]b). In the same way, the SR12813–PXRLBD complex structure superimposed perfectly on the original structure (PDB entry 1ilh; Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]), with an r.s.m.d. of 1.2 Å over 241 matching Cα atoms (LSQ calculation) (Fig. 3[link]c). The only significant difference between the two structures lies in the presence of a single orientation for SR12813, in contrast to the initial structure in which three orientations were modeled for this ligand (Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]). As a consequence, minor differences are observed for some residue side chains within the LBP. The very well defined Fo − Fc omit map clearly shows that in the new structure the ligand adopts the orientation that is also observed in the SR12813–PXRLBD-SRC-1 complex structure (Fig. 3[link]d). These different observations may be attributed to the rather different resolutions at which the structures were determined: 2.76 Å (PDB entry 1ilh; Watkins et al., 2001[Watkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329-2333.]) and 1.60 Å (PDB entry 9fzj).

[Figure 3]
Figure 3
The novel cleavable linker does not affect the structural configuration of the PXRLBD. (a) Superimposition of a known structure (PDB entry 3hvl; gray) and the new structure (PDB entry 9fzi; blue) of PXRLBD-SRC-1 in complex with SR12813 (r.m.s.d. of 0.9 Å over 275 Cα atoms). The SRC-1 peptide moiety is represented in green. (b) A close-up view of the ligand-binding pockets in the PXRLBD-SRC-1 structures. The Fo − Fc simulated-annealing omit map is presented at an r.m.s.d. of 2 for PDB entry 9fzi (2.7 Å resolution). (c) Superimposition of the known structure (PDB entry 1ilh; gray) and new structure (PDB entry 9fzj; purple) of PXRLBD in complex with SR12813 (r.m.s.d. of 1.2 Å over 241 Cα atoms). In PDB entry 1ilh, SR12813 was modeled in three different orientations, unlike PDB entry 9fzj, where it present in one. (d) A close-up view of the ligand-binding pockets in the PXRLBD structures. The ligand of PDB entry 1ilh is not shown for clarity. The Fo − Fc simulated-annealing omit map is presented at an r.m.s.d. of 2 for PDB entry 9fzj (1.6 Å resolution). Oxygen, red; nitrogen, blue; phosphorus, orange. Black dashed lines show hydrogen bonds. Gray dashed lines represent flexible regions that are not visible in the crystal structures.

Following the successful implementation of the new cleavable construct, we have determined the structures of novel complexes with the PXRLBD. This was performed as part of a project aimed at developing a PROTAC (PROteolysis TArgeting Chimera) ligand targeting PXR (Bansard et al., 2024[Bansard, L., Laconde, G., Delfosse, V., Huet, T., Ayeul, M., Rigal, E., Donati, Q., Gerbal-Chaloin, S., Daujat-Chavanieu, M., Legrand, B., Chavanieu, A., Martin, A. R., Pannequin, J., Bourguet, W., Amblard, M. & Pascussi, J. M. (2024). bioRxiv, 2024.06.18.599474.]). PROTACs are bifunctional molecules that work by bridging a specific protein to an E3 ligase, forming a ternary complex. In this way, the PROTAC targets the protein of interest for degradation by hijacking the E3 ligase and the ubiquitin–proteasome system (Pettersson & Crews, 2019[Pettersson, M. & Crews, C. M. (2019). Drug. Discov. Today Technol. 31, 15-27.]). In this context, we have also tested the hydrophobic tagging technology (HyT-technology), whereby proteins become unstable and are subsequently degraded by the proteasome following the addition of a hydrophobic group (for example adamantane) to their surface (Wang et al., 2020[Wang, Y., Jiang, X., Feng, F., Liu, W. & Sun, H. (2020). Acta Pharm. Sin. B, 10, 207-238.]; He et al., 2023[He, Q., Zhao, X., Wu, D., Jia, S., Liu, C., Cheng, Z., Huang, F., Chen, Y., Lu, T. & Lu, S. (2023). Eur. J. Med. Chem. 260, 115741.]). Two new synthetic compounds, named JMV6995 and JMV7035 (Figs. 4[link]a and 4[link]b), have been developed for this purpose. They contain an adamantane moiety linked by a spacer arm to a PXR agonist-based scaffold (Benod et al., 2008[Benod, C., Subra, G., Nahoum, V., Mallavialle, A., Guichou, J.-F., Milhau, J., Roblés, S., Bourguet, W., Pascussi, J.-M., Balaguer, P. & Chavanieu, A. (2008). Bioorg. Med. Chem. 16, 3537-3549.]). The difference between the two lies in the size and the chemical nature of the linker, with JMV7035 containing an additional PEG spacer. JMV6995 and JMV7035 were co-crystallized with the PXRLBD and were unambiguously positioned in the electron density of the resulting structures determined at 2.50 and 2.00 Å resolution, respectively (Fig. 4[link]). This makes JMV7035 the largest ligand to be crystallized with the PXRLBD to date (molecular weight 840.12 g mol−1). Surprisingly, the structures show that the adamantane groups of these compounds did not reach the surface of the PXRLBD, as expected, but were fully internalized into the LBP (Fig. 4[link]). JMV6995 and JMV7035 mainly interact with the PXRLBD through van der Waals and hydrophobic contacts. Only one hydrogen bond is observed to the side chain of Ser247. In both cases, the mesityl sulfonamide group of the PXR agonist moiety is situated between helices H3 and H11, in close proximity to H12 (Figs. 4[link]c and 4[link]d). On the other side of the pocket, the benzyl group is embedded within the aromatic π-trap, which is formed by Phe288, Trp299 and Tyr306 (Delfosse et al., 2021[Delfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.]). The adamantane group is able to fit into the hydrophobic environment created by the aforementioned mesityl sulfonamide and the benzyl groups, with the linker making its way into the rest of the pocket. In the JMV6995 complex, the positioning of the linker has an impact on the stability of loops H2′–S1 and S4–H6, and as a result residues 207–209 and 310–317 could not be modeled (Fig. 4[link]c). With regard to JMV7035, the linker initially follows a similar path and the adamantane group is perfectly superimposed on that of JMV6995 (Figs. 4[link]c and 4[link]d). Furthermore, the positioning of the PEG chain between these two components results in destabilization of the H2′ helix, which is no longer defined by the electron density. Accordingly, the region including residues 178–207 was not modeled. Finally, the carbonyl group of the linker forms a hydrogen bond to a water molecule in the LBP, which in turn interacts via hydrogen bonds to the Ile236 and Leu239 backbones (Fig. 4[link]d). The unobserved regions of these complex structures have been previously described as highly dynamic and, depending on the size of the ligand, could be significantly affected. This is particularly the case for rifampicin, the structure of which showed no clear electron density for residues 178–209, 229–235 and 310–317 (Chrencik et al., 2005[Chrencik, J. E., Orans, J., Moore, L. B., Xue, Y., Peng, L., Collins, J. L., Wisely, G. B., Lambert, M. H., Kliewer, S. A. & Redinbo, M. R. (2005). Mol. Endocrinol. 19, 1125-1134.]; Garcia-Maldonado et al., 2024[Garcia-Maldonado, E., Huber, A. D., Chai, S. C., Nithianantham, S., Li, Y., Wu, J., Poudel, S., Miller, D. J., Seetharaman, J. & Chen, T. (2024). Nat. Commun. 15, 4054.]). Thus, the JMV6995 and JMV7035 complex structures, in which the ligands fold on themselves, once again demonstrate the extraordinary adaptability of the LBP of this receptor.

[Figure 4]
Figure 4
New structures of the PXRLBD in the absence of the SRC-1 peptide. 1D chemical structures of (a) JMV6995 and (b) JMV7035 (Ad, adamantane). Close-up views of the ligand-binding pocket of the PXRLBD in complex with (c) JMV6995 (2.5 Å resolution) and (d) JMV7035 (2.0 Å resolution). The 2mFo − Fc simulated-annealing omit maps are represented at an r.m.s.d. of 1. For clarity, the H11 helix at the front has been truncated. Oxygen, red; nitrogen, blue; sulfur, yellow; w, water. Black dashed lines show hydrogen bonds.

In summary, we have designed a novel construct for the production and purification of high yields of the PXRLBD in fusion with a cleavable SRC-1-derived coactivator peptide that can be removed at will. The choice of one or the other of the resulting proteins will be determined by the studies that are to subsequently be performed. For example, the PXRLBD-Thb-SRC-1 fusion is well suited for use in isothermal titration calorimetry (ITC; Delfosse et al., 2015[Delfosse, V., Dendele, B., Huet, T., Grimaldi, M., Boulahtouf, A., Gerbal-Chaloin, S., Beucher, B., Roecklin, D., Muller, C., Rahmani, R., Cavaillès, V., Daujat-Chavanieu, M., Vivat, V., Pascussi, J. M., Balaguer, P. & Bourguet, W. (2015). Nat. Commun. 6, 8089.], 2021[Delfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.]) or hydrogen–deuterium exchange mass spectrometry (HDX-MS) experiments that require a stable sample over time. In addition, the fusion protein is suitable for ligand-interaction studies, whereas the cleaved form must be used for coregulator interaction experiments. In the context of crystallographic studies, we prefer to use the PXRLBD, for which we were able to determine two new complex structures. This versatile construct is likely to be of interest to other academic and pharmaceutical laboratories interested in structural studies of PXR, particularly for drug-design purposes.

Acknowledgements

We acknowledge the European Synchrotron Radiation Facility (ESRF) for the provision of synchrotron-radiation facilities, and we would like to thank the staff of the ESRF and EMBL Grenoble for assistance and support in using beamlines ID29, ID30A-1 and ID30A-3 under Proposal Nos. MX1976 and MX2409.

Conflict of interest

The authors declare no conflicts of interest.

Funding information

The CBS is part of the ChemBioFrance research infrastructure and is a member of the France-BioImaging (FBI) and the French Infrastructure for Integrated Structural Biology (FRISBI), two national infrastructures supported by the Agence Nationale de la Recherche (ANR-10-INBS-0004 and ANR-10-INBS-0005, respectively); we acknowledge financial support from the Agence Nationale de la Recherche, project SYNERACT (ANR-18-CE34-0009-01), and from Plan Cancer Inserm 2014-19, project SYNERPXR 2.0.

References

First citationBansard, L., Laconde, G., Delfosse, V., Huet, T., Ayeul, M., Rigal, E., Donati, Q., Gerbal-Chaloin, S., Daujat-Chavanieu, M., Legrand, B., Chavanieu, A., Martin, A. R., Pannequin, J., Bourguet, W., Amblard, M. & Pascussi, J. M. (2024). bioRxiv, 2024.06.18.599474.  Google Scholar
First citationBartolini, D., De Franco, F., Torquato, P., Marinelli, R., Cerra, B., Ronchetti, R., Schon, A., Fallarino, F., De Luca, A., Bellezza, G., Ferri, I., Sidoni, A., Walton, W. G., Pellock, S. J., Redinbo, M. R., Mani, S., Pellicciari, R., Gioiello, A. & Galli, F. (2020). J. Med. Chem. 63, 3701–3712.  Web of Science CrossRef CAS PubMed Google Scholar
First citationBautista-Olivier, C. D. & Elizondo, G. (2022). Biochem. Pharmacol. 202, 115147.  Web of Science PubMed Google Scholar
First citationBenod, C., Subra, G., Nahoum, V., Mallavialle, A., Guichou, J.-F., Milhau, J., Roblés, S., Bourguet, W., Pascussi, J.-M., Balaguer, P. & Chavanieu, A. (2008). Bioorg. Med. Chem. 16, 3537–3549.  Web of Science CrossRef PubMed CAS Google Scholar
First citationBuchman, C. D., Chai, S. C. & Chen, T. (2018). Expert Opin. Drug Metab. Toxicol. 14, 635–647.  Web of Science CrossRef CAS PubMed Google Scholar
First citationCheng, Y. & Redinbo, M. R. (2011). Protein Sci. 20, 1713–1719.  Web of Science CrossRef CAS PubMed Google Scholar
First citationChrencik, J. E., Orans, J., Moore, L. B., Xue, Y., Peng, L., Collins, J. L., Wisely, G. B., Lambert, M. H., Kliewer, S. A. & Redinbo, M. R. (2005). Mol. Endocrinol. 19, 1125–1134.  Web of Science CrossRef PubMed CAS Google Scholar
First citationDelfosse, V., Dendele, B., Huet, T., Grimaldi, M., Boulahtouf, A., Gerbal-Chaloin, S., Beucher, B., Roecklin, D., Muller, C., Rahmani, R., Cavaillès, V., Daujat-Chavanieu, M., Vivat, V., Pascussi, J. M., Balaguer, P. & Bourguet, W. (2015). Nat. Commun. 6, 8089.  Web of Science CrossRef PubMed Google Scholar
First citationDelfosse, V., Huet, T., Harrus, D., Granell, M., Bourguet, M., Gardia-Parège, C., Chiavarina, B., Grimaldi, M., Le Mével, S., Blanc, P., Huang, D., Gruszczyk, J., Demeneix, B., Cianférani, S., Fini, J. B., Balaguer, P. & Bourguet, W. (2021). Proc. Natl Acad. Sci. USA, 118, e2020551118.  Web of Science CrossRef PubMed Google Scholar
First citationDuan, J. J., Lu, Z., Jiang, B., Stachura, S., Weigelt, C. A., Sack, J. S., Khan, J., Ruzanov, M., Galella, M. A., Wu, D. R., Yarde, M., Shen, D. R., Shuster, D. J., Borowski, V., Xie, J. H., Zhang, L., Vanteru, S., Gupta, A. K., Mathur, A., Zhao, Q., Foster, W., Salter-Cid, L. M., Carter, P. H. & Dhar, T. G. M. (2019). ACS Med. Chem. Lett. 10, 367–373.  Web of Science CrossRef CAS PubMed Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFan, S., Yan, Y., Xia, Y., Zhou, Z., Luo, L., Zhu, M., Han, Y., Yao, D., Zhang, L., Fang, M., Peng, L., Yu, J., Liu, Y., Gao, X., Guan, H., Li, H., Wang, C., Wu, X., Zhu, H., Cao, Y. & Huang, C. (2023). Nat. Commun. 14, 3368.  Web of Science CrossRef PubMed Google Scholar
First citationFeng, F., Jiang, Q., Cao, S., Cao, Y., Li, R., Shen, L., Zhu, H., Wang, T., Sun, L., Liang, E., Sun, H., Chai, Y., Li, X., Liu, G., Yang, R., Yang, Z., Yang, Y., Xin, S. & Li, B. (2018). Biochim. Biophys. Acta, 1862, 1017–1030.  Web of Science CrossRef CAS Google Scholar
First citationFocken, T., Burford, K., Grimwood, M. E., Zenova, A., Andrez, J. C., Gong, W., Wilson, M., Taron, M., Decker, S., Lofstrand, V., Chowdhury, S., Shuart, N., Lin, S., Goodchild, S. J., Young, C., Soriano, M., Tari, P. K., Waldbrook, M., Nelkenbrecher, K., Kwan, R., Lindgren, A., de Boer, G., Lee, S., Sojo, L., DeVita, R. J., Cohen, C. J., Wesolowski, S. S., Johnson, J. P., Dehnhardt, C. M. & Empfield, J. R. (2019). J. Med. Chem. 62, 9618–9641.  Web of Science CSD CrossRef CAS PubMed Google Scholar
First citationGarcia-Maldonado, E., Huber, A. D., Chai, S. C., Nithianantham, S., Li, Y., Wu, J., Poudel, S., Miller, D. J., Seetharaman, J. & Chen, T. (2024). Nat. Commun. 15, 4054.  Web of Science PubMed Google Scholar
First citationGee, R. R. F., Huber, A. D. & Chen, T. (2024). Expert Opin. Drug Metab. Toxicol. 20, 9–23.  Web of Science CrossRef CAS PubMed Google Scholar
First citationGong, H., Weinstein, D. S., Lu, Z., Duan, J. J., Stachura, S., Haque, L., Karmakar, A., Hemagiri, H., Raut, D. K., Gupta, A. K., Khan, J., Camac, D., Sack, J. S., Pudzianowski, A., Wu, D. R., Yarde, M., Shen, D. R., Borowski, V., Xie, J. H., Sun, H., D'Arienzo, C., Dabros, M., Galella, M. A., Wang, F., Weigelt, C. A., Zhao, Q., Foster, W., Somerville, J. E., Salter-Cid, L. M., Barrish, J. C., Carter, P. H. & Dhar, T. G. M. (2018). Bioorg. Med. Chem. Lett. 28, 85–93.  Web of Science CSD CrossRef CAS PubMed Google Scholar
First citationHall, A., Chanteux, H., Ménochet, K., Ledecq, M. & Schulze, M. E. D. (2021). J. Med. Chem. 64, 6413–6522.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHe, Q., Zhao, X., Wu, D., Jia, S., Liu, C., Cheng, Z., Huang, F., Chen, Y., Lu, T. & Lu, S. (2023). Eur. J. Med. Chem. 260, 115741.  Web of Science CrossRef PubMed Google Scholar
First citationHennessy, E. J., Oza, V., Adam, A., Byth, K., Castriotta, L., Grewal, G., Hamilton, G. A., Kamhi, V. M., Lewis, P., Li, D., Lyne, P., Öster, L., Rooney, M. T., Saeh, J. C., Sha, L., Su, Q., Wen, S., Xue, Y. & Yang, B. (2015). J. Med. Chem. 58, 7057–7075.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHillisch, A., Gericke, K. M., Allerheiligen, S., Roehrig, S., Schaefer, M., Tersteegen, A., Schulz, S., Lienau, P., Gnoth, M., Puetter, V., Hillig, R. C. & Heitmeier, S. (2020). J. Med. Chem. 63, 12574–12594.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHuber, A. D., Poudel, S., Li, Y., Lin, W., Wu, J., Miller, D. J. & Chen, T. (2023). Structure, 31, 1545–1555.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHuber, A. D., Poudel, S., Wu, J., Miller, D. J., Lin, W., Yang, L., Bwayi, M. N., Rimmer, M. A., Gee, R. R. F., Seetharaman, J., Chai, S. C. & Chen, T. (2024). Nucleic Acids Res. 52, 1661–1676.  Web of Science CrossRef CAS PubMed Google Scholar
First citationKabsch, W. (2010a). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKabsch, W. (2010b). Acta Cryst. D66, 133–144.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKhan, J. A., Camac, D. M., Low, S., Tebben, A. J., Wensel, D. L., Wright, M. C., Su, J., Jenny, V., Gupta, R. D., Ruzanov, M., Russo, K. A., Bell, A., An, Y., Bryson, J. W., Gao, M., Gambhire, P., Baldwin, E. T., Gardner, D., Cavallaro, C. L., Duncia, J. V. & Hynes, J. (2015). J. Mol. Biol. 427, 924–942.  Web of Science CrossRef CAS PubMed Google Scholar
First citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
First citationLin, W., Huber, A. D., Poudel, S., Li, Y., Seetharaman, J., Miller, D. J. & Chen, T. (2023). Proc. Natl Acad. Sci. USA, 120, e2217804120.  Web of Science CrossRef PubMed Google Scholar
First citationLin, W., Wang, Y. M., Chai, S. C., Lv, L., Zheng, J., Wu, J., Zhang, Q., Wang, Y. D., Griffin, P. R. & Chen, T. (2017). Nat. Commun. 8, 741.  Web of Science CrossRef PubMed Google Scholar
First citationLv, Y., Luo, Y.-Y., Ren, H.-W., Li, C.-J., Xiang, Z.-X. & Luan, Z.-L. (2022). Front. Endocrinol. 13, 959902.  Web of Science CrossRef Google Scholar
First citationPettersson, M. & Crews, C. M. (2019). Drug. Discov. Today Technol. 31, 15–27.  CrossRef PubMed Google Scholar
First citationPlanque, C., Rajabi, F., Grillet, F., Finetti, P., Bertucci, F., Gironella, M., Lozano, J. J., Beucher, B., Giraud, J., Garambois, V., Vincent, C., Brown, D., Caillo, L., Kantar, J., Pelegrin, A., Prudhomme, M., Ripoche, J., Bourgaux, J. F., Ginestier, C., Castells, A., Hollande, F., Pannequin, J. & Pascussi, J. M. (2016). Oncotarget, 7, 56558–56573.  Web of Science CrossRef PubMed Google Scholar
First citationRakateli, L., Huchzermeier, R. & van der Vorst, E. P. C. (2023). Cells, 12, 2752.  Web of Science CrossRef PubMed Google Scholar
First citationRamanjulu, J. M., Williams, S. P., Lakdawala, A. S., DeMartino, M. P., Lan, Y. & Marquis, R. W. (2021). ACS Med. Chem. Lett. 12, 1396–1404.  Web of Science CrossRef CAS PubMed Google Scholar
First citationRao, Z.-Z., Tang, Z.-W. & Wen, J. (2023). World J. Clin. Oncol. 14, 335–342.  Web of Science CrossRef PubMed Google Scholar
First citationSantella, J. B., Gardner, D. S., Duncia, J. V., Wu, H., Dhar, M., Cavallaro, C., Tebben, A. J., Carter, P. H., Barrish, J. C., Yarde, M., Briceno, S. W., Cvijic, M. E., Grafstrom, R. R., Liu, R., Patel, S. R., Watson, A. J., Yang, G., Rose, A. V., Vickery, R. D., Caceres-Cortes, J., Caporuscio, C., Camac, D. M., Khan, J. A., An, Y., Foster, W. R., Davies, P. & Hynes, J. (2014). J. Med. Chem. 57, 7550–7564.  Web of Science CrossRef CAS PubMed Google Scholar
First citationSchneider, M., Delfosse, V., Gelin, M., Grimaldi, M., Granell, M., Heriaud, L., Pons, J. L., Cohen Gonsaud, M., Balaguer, P., Bourguet, W. & Labesse, G. (2022). J. Med. Chem. 65, 1552–1566.  Web of Science CrossRef CAS PubMed Google Scholar
First citationSivaprakasam, P., Wang, Z., Meanwell, N. A., Khan, J. A., Langley, D. R., Johnson, S. R., Li, G., Pendri, A., Connolly, T. P., Gao, M., Camac, D. M., Klakouski, C., Zvyaga, T., Cianci, C., McAuliffe, B., Ding, B., Discotto, L., Krystal, M. R., Jenkins, S., Peese, K. M. & Narasimhulu Naidu, B. (2020). Bioorg. Med. Chem. Lett. 30, 127531.  Web of Science CrossRef PubMed Google Scholar
First citationToporova, L. & Balaguer, P. (2020). Mol. Cell. Endocrinol. 502, 110665.  Web of Science CrossRef PubMed Google Scholar
First citationVaz, R. J., Li, Y., Chellaraj, V., Reiling, S., Kuntzweiler, T., Yang, D., Shen, H., Batchelor, J. D., Zhang, Y., Chen, X., McLean, L. R. & Kosley, R. (2018). Bioorg. Med. Chem. Lett. 28, 3194–3196.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWang, J., Lu, P. & Xie, W. (2022). Med. Rev. 2, 611–624.  CrossRef Google Scholar
First citationWang, W., Prosise, W. W., Chen, J., Taremi, S. S., Le, H. V., Madison, V., Cui, X., Thomas, A., Cheng, K. C. & Lesburg, C. A. (2008). Protein Eng. Des. Sel. 21, 425–433.  Web of Science CrossRef PubMed Google Scholar
First citationWang, Y., Jiang, X., Feng, F., Liu, W. & Sun, H. (2020). Acta Pharm. Sin. B, 10, 207–238.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWatkins, R. E., Davis-Searles, P. R., Lambert, M. H. & Redinbo, M. R. (2003). J. Mol. Biol. 331, 815–828.  Web of Science CrossRef PubMed CAS Google Scholar
First citationWatkins, R. E., Maglich, J. M., Moore, L. B., Wisely, G. B., Noble, S. M., Davis-Searles, P. R., Lambert, M. H., Kliewer, S. A. & Redinbo, M. R. (2003). Biochemistry, 42, 1430–1438.  Web of Science CrossRef PubMed CAS Google Scholar
First citationWatkins, R. E., Wisely, G. B., Moore, L. B., Collins, J. L., Lambert, M. H., Williams, S. P., Willson, T. M., Kliewer, S. A. & Redinbo, M. R. (2001). Science, 292, 2329–2333.  Web of Science CrossRef PubMed CAS Google Scholar
First citationWerner, S., Mesch, S., Hillig, R. C., ter Laak, A., Klint, J., Neagoe, I., Laux-Biehlmann, A., Dahllöf, H., Bräuer, N., Puetter, V., Nubbemeyer, R., Schulz, S., Bairlein, M., Zollner, T. M. & Steinmeyer, A. (2019). J. Med. Chem. 62, 11194–11217.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWilliams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, D. C. (2018). Protein Sci. 27, 293–315.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWillson, T. M. & Kliewer, S. A. (2002). Nat. Rev. Drug Discov. 1, 259–266.  Web of Science CrossRef PubMed CAS Google Scholar
First citationXue, Y., Chao, E., Zuercher, W. J., Willson, T. M., Collins, J. L. & Redinbo, M. R. (2007). Bioorg. Med. Chem. 15, 2156–2166.  Web of Science CrossRef PubMed CAS Google Scholar
First citationYu, J., Wang, Y. & Ragueneau-Majlessi, I. (2022). Clin. Ther. 44, 1536–1544.  Web of Science CrossRef CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds