research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Crystal structure of a seven-substitution mutant of hydroxynitrile lyase from rubber tree

crossmark logo

aDepartment of Biochemistry, Molecular Biology and Biophysics, University of Minnesota, Minneapolis, Minnesota, USA, and bCrown College, Saint Bonifacius, Minnesota, USA
*Correspondence e-mail: [email protected], [email protected]

Edited by F. T. Tsai, Baylor College of Medicine, Houston, USA (Received 3 June 2025; accepted 5 August 2025; online 27 August 2025)

The α/β-hydrolase fold superfamily includes esterases and hydroxynitrile lyases which, despite catalyzing different reactions, share a Ser–His–Asp catalytic triad. We report a 1.99 Å resolution crystal structure of HNL6V, an engineered variant of hydroxynitrile lyase from Hevea brasiliensis (HbHNL) containing seven amino-acid substitutions (T11G, E79H, C81L, H103V, N104A, G176S and K236M). The structure reveals that HNL6V maintains the characteristic α/β-hydrolase fold while exhibiting systematic shifts in backbone and catalytic atom positions. Compared with wild-type HbHNL, the Cα positions in HNL6V differ by a mean of 0.2 ± 0.1 Å, representing a statistically significant displacement. Importantly, the catalytic triad and oxyanion-hole atoms have moved 0.2–0.8 Å closer to their corresponding positions in SABP2, although they remain 0.3–1.1 Å from fully achieving the configuration of SABP2. The substitutions also increase local flexibility, particularly in the lid domain covering the active site. This structural characterization demonstrates that targeted amino-acid substitutions can systematically shift catalytic geometries towards those of evolutionarily related enzymes.

1. Introduction

Hydroxynitrile lyases (HNLs) catalyze the enantioselective interconversion of cyanohydrins and aldehydes/ketones (Bracco et al., 2016View full citation; Lanfranchi et al., 2013View full citation; Dadashipour & Asano, 2011View full citation). HNLs occur in at least four protein folds; this paper focuses on HNLs with an α/β-hydrolase fold. This fold consists of eight β-strands connected by α-helices and contains a catalytic triad, typically Ser–His–Asp (Ollis et al., 1992View full citation; Bauer et al., 2020View full citation). One example of an HNL with an α/β-hydrolase fold is the hydroxynitrile lyase from the Pará rubber tree Hevea brasiliensis (HbHNL).

Most enzymes in the α/β-hydrolase fold superfamily are esterases. HNLs in this superfamily, such as HbHNL, diverged from esterases approximately 100 million years ago (Rauwerdink et al., 2016View full citation; Devamani et al., 2016View full citation). HbHNL shares 44% sequence identity and 62% similarity over 260 positions with the modern esterase SABP2 (salicylic acid-binding protein 2 from tobacco; Supplementary Fig. S1). HbHNL and SABP2 also use the same Ser–His–Asp catalytic triad even though the catalytic mechanisms of ester hydrolysis and cyanohydrin cleavage differ significantly (Zuegg et al., 1999View full citation).

In this work, we report the structure of a seven-substitution variant of HbHNL. Six of the seven substitutions replace residues in and around the active site with a corresponding residue from SABP2 (Thr11Gly, Glu79His, Cys81Leu, Asn104Ala, Gly176Ser and Lys236Met). The seventh substitution, His103Val, introduces an amino acid similar to the leucine in SABP2. A similar histidine-to-valine substitution in the homologous hydroxynitrile lyase from Baliospermum montanum stabilized the protein (Dadashipour et al., 2011View full citation). Comparison of the catalytic atom positions shows that they have moved closer to the positions in SABP2 but still differ by 0.3–1.1 Å. The largest statistically significant differences are in the positions of the histidine Nɛ2 and aspartate Oδ2.

2. Materials and methods

2.1. Protein production and purification

The gene encoding the wild-type HNL from H. brasiliensis in the pSE420 plasmid (Hasslacher et al., 1996View full citation) was recloned into a pET-21a(+) plasmid (Table 1[link]). The enzyme variant HNL6V was constructed via inverse PCR (Ochman et al., 1988View full citation) using non-overlapping mutagenic primers in a sequential manner starting from HNL3V (Nedrud et al., 2014View full citation). Briefly, mutagenic primers were annealed to the plasmid template in a back-to-back, outward-facing orientation and were amplified using New England Biolabs (NEB) Q5 HiFi polymerase (M0491S) to produce a linear, double-stranded DNA product containing the desired mutation(s). Primers were designed using the NEBaseChanger (https://nebasechanger.neb.com) web tool and checked for secondary structure and self-dimer/heterodimer propensity with the OligoAnalyzer Tool (https://www.idtdna.com/pages/tools/oligoanalyzer) from Integrated DNA Technologies (IDT), Coralville, Iowa, USA. Primers were purchased from IDT and used without further purification. PCR was performed using a Bio-Rad 2000 Thermal Cycler with the following conditions: initial denaturation at 98°C for 30 s, 30 cycles of denaturation (98°C for 30 s), annealing (calculated annealing temperature for 25 s) and extension (72°C for 150 s), and a final extension step of 72°C for 30 s. The PCR products were treated with a KLD enzyme mix (NEB M0554S), which phosphorylates the 5′ ends of the linearized PCR products, ligates the phosphorylated ends and degrades the original plasmid template. 5 µl of KLD product was used directly to transform chemically competent Escherichia coli DH5α cells (NEB C2988) according to the manufacturer's protocol and plate them onto lysogeny broth (LB) plates containing 100 µg ml−1 carbenicillin. After overnight growth at 37°C, individual colonies were picked and grown overnight in LB medium and the plasmids were extracted using a NEB Monarch Plasmid mini-prep kit (NEB T1010). Plasmid concentrations were measured spectrophoto­metrically at 260 nm using a NanoDrop 2000 (Thermo Scientific) and diluted to <1.0 OD units if necessary. Sanger sequencing from Genewiz/Azenta Life Sciences (Indianapolis, Indiana, USA) was used to confirm mutations. The sequence-confirmed plasmid was transformed into E. coli strain BL21 (NEB C2530H) chemically competent cells according to the NEB transformation protocol and plated onto LB plates containing 100 µg ml−1 carbenicillin.

Table 1
Macromolecule-production information

Source organism Hevea brasiliensis
DNA source Hasslacher et al. (1996View full citation)
Forward primers
 C81L CAGCCTGGGAGGACTCAATATAGCAATTG
 N104A TGTTTTCGTCGCGTCAGTATTGCCAGACAC
 G176S GACAAGGAAGAGCTCATTATTTCAAAATATTTTAGC
Reverse primers
 C81L TGGCCAACCAGAATCACCTTTTCCCC
 N104A GCAGCTGCAATCTTTTCAC
 G176S AACATCTTCGCCAGTTCATATTC
Expression vector pET-21a(+)
Expression host E. coli BL21
Complete amino-acid sequence of the construct produced MAFAHFVLIHGICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGHSLGGLNIAIAADKYCEKIAAAVFVASVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKSSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHMLQLTKTKEIAEILQEVADTYNLEHHHHHH

To express the HNL6V variant protein, LB medium containing carbenicillin (100 µg ml−1, 5 ml) was inoculated with a single bacterial colony from an agar plate and incubated in an orbital shaker at 37°C and 240 rev min−1 for 15 h to create a seed culture. A 1 l baffled flask containing Terrific Broth–Amp medium (250 ml) was inoculated with this seed culture. This culture was incubated at 37°C and 240 rev min−1 for 3–4 h until the absorbance at 600 nm reached 0.4–1.0 and was then cooled on ice for 30 min. Isopropyl β-D-1-thio­galactopyranoside (0.75–1.0 mM final concentration) was added to induce protein expression, and cultivation was continued for 20 h at 18°C. The cells were harvested by centrifugation (4°C, 7000 rev min−1, 15 min), resuspended in Ni–NTA loading buffer (10 mM imidazole, 50 mM Tris pH 8.0, 500 mM NaCl, 4 ml per gram of wet cells) and disrupted by sonication (400 W, 40% amplitude for 5 min). The cell lysate was centrifuged to pellet the cell debris (4°C, 12 000 rev min−1 for 45 min) and the supernatant was mixed with 1–2.5 ml Ni–NTA resin (pre-equilibrated with 10 ml Ni–NTA loading buffer) and incubated for 45 min at 4°C with rotation (10 rev min−1). The resin/supernatant mixture was loaded onto a 25 ml column (Bio-Rad) and the resin was washed with ten column volumes each of buffer containing increasing amounts of imidazole (25–50 mM imidazole, 50 mM Tris pH 8.0, 500 mM NaCl). The His-tagged protein was eluted with ten column volumes of elution buffer and collected in 1 ml fractions (125 mM imidazole, 50 mM Tris pH 8.0, 500 mM NaCl). The protein concentration of each elution fraction was determined from spectrophotometric measurements at 280 nm using a NanoDrop 2000 (Thermo Scientific). The calculated extinction coefficient (45 380 M−1 cm−1) was determined using the ProtParam computational web tool (https://web.expasy.org/protparam; Gasteiger et al., 2005View full citation). Protein gels were used to check for the presence and purity of protein and were run using sodium dodecyl sulfate polyacrylamide gradient gels (NuPage 4−12% Bis-Tris gel from Invitrogen) using the Precision Plus Dual Color protein standard (Bio-Rad, 5 µl in each lane) for 50 min at 150 V, stained with SimplyBlue Safe Stain (Thermo Fisher Scientific) and destained twice with Milli-Q UltraPure H2O. SDS–PAGE indicated a molecular weight of ∼30 kDa, in agreement with the predicted weight of 31.1 kDa. The imidazole-containing elution buffer was exchanged by the addition of BES buffer [5 mM N,N-bis(2-hydroxyethyl)-2-amino­ethanesulfonic acid pH 7.2, 14 ml] followed by ultrafiltration (Amicon 15 ml ultrafiltration centrifuge filter, 10 kDa cutoff) to reduce the volume to ∼250 µl. This addition of buffer and filtration was repeated four times. A 250 ml culture yielded 2.2 mg of protein.

2.2. Crystallization

Crystallographic screening was performed using a Phoenix crystallography dispenser from Art Robbins Instruments. Low-profile Intelli-Plate sitting-drop vapor-diffusion trays from Art Robbins Instruments were used for crystallization setup. All of the setup and washing procedures were performed through the Art Robbins Instruments Phoenix software. Each crystallization drop contained 0.1 µl protein sample (9.3 mg ml−1 protein) and 0.1 µl well solution. A total of 960 conditions were tested. Crystals appeared within one day from the Index HT screen from Hampton Research under the condition 0.1 M bis-Tris pH 5.5, 2 M ammonium sulfate and grew to a full size of 0.35 mm in three days (Fig. 1[link], Table 2[link]). The data from the crystals obtained by robotic screening proved sufficient to refine the model so additional crystal screening trays were not needed.

Table 2
Crystallization

Method Vapor diffusion, sitting drop
Plate type CrystalMation Intelli-Plate 96-3 low-profile
Temperature (K) 293
Protein concentration (mg ml−1) 9.3
Buffer composition of protein solution 5 mM BES pH 7.2
Composition of reservoir solution 0.1 M bis-Tris pH 5.5, 2 M ammonium sulfate
Volume and ratio of drop (µl) 200, 1:1 (protein:screen solution)
Volume of reservoir (µl) 50
[Figure 1]
Figure 1
HNL6V crystal used for data collection prior to extraction or soaking. Growth conditions: 0.1 M bis-Tris pH 5.5, 2.0 M ammonium sulfate. The HNL6V crystals measured 90 × 175 µm (left) and 350 × 300 µm (right). The larger right crystal was harvested for data collection. The five circular `bubbles' are optical artifacts of the microscope.

2.3. Data collection, processing and structure refinement

Crystals were transferred into cryoprotectant solutions consisting of well-solution components and increasing concentrations of sodium malonate. The final concentration of sodium malonate in the cryoprotectant solution was 1.2 M. Harvested crystals were flash-cooled in liquid nitrogen. The structural data set was collected on beamline 24-ID-C (NE-CAT) at the Advanced Photon Source (APS), Argonne National Laboratory at an oscillation angle of 0.2°. Reconstructed ancestral hydroxynitrile lyase (Jones et al., 2020View full citation; PDB entry 5tdx) with 76% sequence identity was used for molecular replacement and refined to a 2.3 Å resolution model. This 2.3 Å resolution initial model was used to aid in the refinement of the second and final model, resulting in a 1.99 Å resolution structure. HKL-2000 (Otwinowski & Minor, 1997View full citation) was used to process the collected data and Phaser (McCoy et al., 2007View full citation) in Phenix (Liebschner et al., 2019View full citation) was used for molecular replacement and refinement. Refinement modeling was performed using Coot (Emsley et al., 2010View full citation). During structural refinement, electron density was observed in the active site, but no ligand was found to sufficiently fulfill the electron density (Supplementary Fig. S2). The final data-collection and refinement statistics are shown in Tables 3[link] and 4[link], respectively. The final model was deposited in the Research Collaboratory for Structural Bioinformatics Protein Data Bank (PDB entry 8euo).

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source 24-ID-C, APS
Wavelength (Å) 0.979
Detector Dectris EIGER2 S 16M
Crystal-to-detector distance (cm) 230
Rotation range per image (°) 0.2
Exposure time per image (s) 0.2
Space group C2221
a, b, c (Å) 47.05, 106.38, 128.40
α, β, γ (°) 90, 90, 90
Mosaicity (°) 0.2
Resolution range (Å) 43.03–1.99 (2.04–1.99)
Total No. of reflections 102923 (7877)
No. of unique reflections 20181 (1606)
Completeness (%) 89.43 (89,95)
Multiplicity 5.1
〈I/σ(I)〉 13.9 (2.3)
Rr.i.m. 0.032 (0.490)
Overall B factor from Wilson plot (Å2) 28.09

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

No. of reflections, working set 20178 (2005)
No. of reflections, test set 2000 (199)
Final Rwork 0.1849 (0.2285)
Final Rfree 0.2374 (0.2603)
No. of non-H atoms
 Protein 2030
 Ligand 0
 Solvent 123
 Total 2162
R.m.s. deviations
 Bonds (Å) 0.009
 Angles (°) 1.03
Ramachandran plot
 Favored (%) 96.44
 Allowed (%) 3.56
 Outliers (%) 0.0

The Protein Data Bank contains 18 structures of wild-type hydroxynitrile lyase from H. brasiliensis, which were used for comparison: PDB entries 1sci, 1sck, 1scq, 1sc9 (Gruber et al., 2004View full citation), 1yas (Wagner et al., 1996View full citation), 2yas, 3yas, 4yas, 5yas, 6yas, 7yas (Zuegg et al., 1999View full citation), 1yb6, 1yb7 (Gartler et al., 2007View full citation), 3c70, 3c6x, 3c6y, 3c6z (Schmidt et al., 2008View full citation) and 1qj4 (Gruber et al., 1999View full citation). The three structures of salicylic acid-binding protein 2 from tobacco used for comparison have the following PDB codes: 1y7i, 1y7h and 1xkl (Forouhar et al., 2001View full citation). PyMOL v.2.5.4 and v.3.0 were used to create images of protein structures (Schrödinger; https://pymolwiki.org). The supporting information contains an example PyMOL script to align the structures using the align function and measure distances between corresponding Cα atoms in the HNL6V structure and 18 HbHNL structures. The statistical significance of the mean distance between Cα atoms in HNL6V and the 18 HbHNL structures and the mean distance between Cα atoms in one HbHNL structure with the other 17 HbHNL structures (all 153 possible pairwise combinations) was analyzed for significance using a two-tailed t-test with unequal variances (Welch's t-test) using equation (1)[link]. The t-test, degrees of freedom and p-value were calculated using a web tool (https://www.statskingdom.com/150MeanT2uneq.html).

Mathematical equation

3. Results and discussion

3.1. Crystallization and structure determination

HNL6V containing a C-terminal His6-tag was expressed from a pET-21a(+) plasmid containing the gene for HNL6V in E. coli BL21. The protein was purified using nickel-affinity chromatography and concentrated to 9.3 mg ml−1. Screening of crystallization conditions yielded initial crystals within one day and full-size crystals within three days (Fig. 1[link]). The harvested crystal belonged to space group C2221, with unit-cell parameters a = 47.05, b = 106.38, c = 128.40 Å and one molecule per asymmetric unit. The structure of a reconstructed ancestral hydroxynitrile lyase (Jones et al., 2020View full citation) with 76% sequence identity was used for molecular replacement. The model was refined to 1.99 Å resolution, with Rwork and Rfree values of 0.1844 and 0.2376, respectively (Table 4[link]).

Structural refinement revealed 2Fo − Fc (blue) and Fo − Fc (red/green) electron density in the active site which could not be assigned to a ligand (Supplementary Fig. S2). Placing water, glycerol, malonate or sulfate in various orientations within this region did not improve the Rwork and Rfree statistics, nor did these placements satisfy the density. As this electron density near the catalytic serine Oγ remains unmodeled, this model should be considered a putative structure. Zuegg et al. (1999View full citation) also observed unidentified electron density near the active site during their refinement of an X-ray crystal structure of wild-type HbHNL.

3.2. Structural analysis

HNL6V adopts the same protein fold as wild-type HbHNL. The catalytic domain follows the α/β-hydrolase fold and contains the catalytic triad and oxyanion-hole residues (Fig. 2[link]a). The lid or cap domain (residues 115–178; Wagner et al., 1996View full citation) covers the active site to create a substrate-binding pocket. The seven amino-acid substitutions in HNL6V were in and around the active site. Six of the substitutions are in the catalytic domain; only Gly176Ser is in the lid domain. None of the substitutions were on the protein surface.

[Figure 2]
Figure 2
Locations of substitutions and displacements of Cα positions in HN6V (PDB entry 8euo) relative to wild-type HNL from H. brasiliensis. Both figures show the catalytic triad (Ser80, His235 and Asp207) in orange sticks with the Oγ atom of Ser80 in red at the center of the figure. The pink spheres show the Cα atoms of the seven substitutions (Thr11Gly, Glu79His, Cys81Leu, His103Val, Asn104Ala, Gly176Ser and Lys236Met). (a) Ribbon diagram of the X-ray structure of HNL6V (PDB entry 8euo) showing the catalytic domain (α/β-hydrolase fold) in green and the lid domain in blue (residues 115–178). Substitution Gly176Ser is in the lid domain, while the other six are in the catalytic domain. (b) Displacement of Cα positions in HNL6V compared with HbHNL (PDB entry 3c6x). The larger diameter and warmer colors in the cartoon representation indicate larger Cα displacements between structures. The large displacements at the N- and C-termini and the smaller surface-residue displacements are likely to be due to differences in crystallization contacts and unrelated to the substitutions. Among the seven substitutions, only His103Val and Asn104Ala exhibit significant displacement, along with the neighboring residue Ser105. The remaining five substitutions maintain their Cα positions but induce conformational changes in adjacent residues (labeled in turquoise).

The distances between corresponding atom positions in HNL6V and those in HbHNL or SABP2 are typically <1 Å. The statistical significance of these differences relies on a two-tailed t-test with unequal variance (Welch's t-test), which relies on the number of independent comparisons. The Protein Data Bank contains 18 independent structures of HbHNL, but only three independent structures of SABP2. Because of this difference in the number of comparison structures, the comparisons between HNL6V and HbHNL are often statistically significant, while those between HNL6V and SABP2 are rarely statistically significant.

The Cα positions in HNL6V differ from those in the parent HbHNL. There are 18 structures of wild-type HNL from H. brasiliensis available in the Protein Data Bank. Pairwise superposition of these structures with each other (153 pairs) using the align function of PyMOL yielded a mean distance of 0.13 ± 0.09 Å between the corresponding Cα atoms. In contrast, pairwise superposition of HNL6V onto these 18 wild-type structures yielded a larger mean distance of 0.2 ± 0.1 Å between corresponding Cα atoms. (The supplementary information includes a PyMOL script for this calculation.) The difference between HNL6V–HbHNL mean distances and HbHNL–HbHNL mean distances is significant (two-tailed p-value = 0.01) using a two-sample t-test with unequal variances. Thus, the seven amino-acid substitutions in HNL6V changed the backbone positions compared with wild-type HbHNL.

The Cα positions in HNL6V do not differ from those in the target SABP2 at a statistically significant level. Pairwise superposition of the three SABP2 structures with each other (three pairs) yielded a mean distance of 0.21 ± 0.07 Å between the corresponding Cα atoms. Pairwise superposition of HNL6V onto these three structures yielded a larger mean distance of 0.6 ± 0.3 Å between corresponding Cα atoms. In spite of this larger distance, the difference between HNL6V–SABP2 mean distances and SABP2–SABP2 mean distances is not significant (two-tailed p-value = 0.14) using a two-sample t-test with unequal variances. This uncertain result is partly due to the lower statistical power when comparing only three SABP2 structures, compared with the 18 HbHNL structures above.

The five catalytic atom positions in HNL6V are all closer to those in HbHNL than to those in SABP2 (Table 5[link]), but they lie between the two average positions of the wild-type proteins (Fig. 3[link]). The differences are statistically significant for the Asp Oδ2 and His Nɛ2 positions, but not for the other three, mainly because of the fewer SABP2 comparison structures. This shift shows that the substitutions have made the catalytic atom positions in HNL6V closer to those in SABP2, but they still resemble the catalytic positions of HbHNL more closely than those of SABP2.

Table 5
Comparison of the structure of HNL6V with 18 HbHNL structures and three SABP2 structures

Comparison atoms Distance between three SABP2 structures (Å) Distance between HNL6V and HbHNL structures (Å) Distance between HNL6V and SABP2 structures (Å) Statistically significant†
All Cα   0.2 ± 0.1 0.6 ± 0.3 No
Ser Oγ 1.6 ± 0.6 0.8 ± 0.4 1.1 ± 0.8 No
His Nɛ2 0.31 ± 0.1 0.3 ± 0.3 0.77 ± 0.07 Highly significant
Asp Oδ2 0.25 ± 0.07 0.2 ± 0.1 0.77 ± 0.05 Highly significant
OX1 N 0.25 ± 0.03 0.43 ± 0.09 0.9 ± 0.2 No
OX2 N 0.33 ± 0.06 0.21 ± 0.07 0.26 ± 0.09 No
†Statistically significant differences between HNL6V–HbHNL differences and HNL6V–SABP2 differences.
[Figure 3]
Figure 3
Best-fit overlay of the Cα positions of SABP2 structures (three structures, light blue C atoms) and HbHNL structures (18 structures, white C atoms) onto the structure of HNL6V (green sticks). (a) The catalytic atoms of the catalytic triad in HNL6V (Oγ of Ser80, Nɛ2 of His235, Oδ2 of Asp207) overlay more closely with the corresponding atoms in the HbHNL structures (Ser80, His235 and Asp207) than with the corresponding atoms in the SABP2 structures (Ser81, His238 and Asp210). (b) The oxyanion-hole amide N atoms of Ile12 and Leu81 in HNL6V overlay more closely with the corresponding atoms in HbHNL (Ile12 and Cys81) than with the corresponding atoms in SABP2 (Ala13 and Leu82). The average distances are listed in Table 5[link]. The side-chain conformations differ at OX2 (Cys81 in HbHNL, Leu82 in SABP2) and HNL6V maintains an HbHNL-like conformation despite the Cys81Leu substitution.

The side-chain conformation differs at OX2 in SABP2 and HbHNL, and HNL6V maintains the HbHNL-like conformation. In SABP2 the side chain of Leu82 points away from the region where the oxyanion is expected to bind, but in HbHNL the side chain of Cys81 points towards this region (Fig. 3[link]b). Although HNL6V contains the Cys81Leu substitution, the side chain of the leucine still points in the same direction as the cysteine in HbHNL.

The seven substitutions in HNL6V change the Cα positions at at the substitution sites and at some adjacent residues. Fig. 2[link](b) and Table 6[link] compare a single high-resolution (1.05 Å) wild-type HbHNL structure (PDB entry 3c6x) with HNL6V. The mean Cα displacement (0.20 ± 0.18 Å over 244 of 257 atoms) is similar to the mean for the comparison of all 18 structures. Some differences between the two structures are likely to be due to different crystallization conditions rather than the engineered mutations: large deviations at the N-terminus (Phe3, ΔCα = 0.96 Å) and C-terminus (Tyr256, ΔCα = 0.62 Å; Asn257, ΔCα = 2.4 Å), as well as smaller differences at various positions on the protein surface. Among the seven amino-acid substitutions, the Cα positions at Asn104Ala and His103Val shift moderately (0.50 and 0.37 Å, respectively, similar to that in the mean values above), with the adjacent residue Ser105 also shifting (0.41 Å). The Gly176Ser mutation shows minimal displacement at the substitution site (0.23 Å), but the Cα positions at the adjacent residues Ser177 and Leu178 change by a larger amount (0.39 and 0.49 Å, respectively). Similarly, Lys236Met causes an average displacement at the substitution site (0.23 Å), while the Cα atom at the adjacent Leu237 moves twice as much (0.46 Å). The remaining substitutions (Thr11Gly, Glu79His and Cys81Leu) show average or smaller displacements at their respective positions (0.23, 0.25 and 0.09 Å, respectively), but also cause displacements nearby. Ile12 (an oxyanion-hole residue next to Thr11Gly) and Ser80 (the catalytic serine next to Cys81Leu) both move by 0.33 Å. In addition, Gly83 on the subsequent helical turn to Cys81Leu also moves by 0.35 Å.

Table 6
Change in Cα positions at the substitution location and at nearby residues

Comparison between HNL6V (PDB entry 8euo) and HbHNL (PDB entry 3c6x). Larger than average changes are in bold.

Substitution Displacement at substitution site (Å) Displacement at adjacent residues (Å)
Thr11Gly 0.23 Ile12 (OX1), 0.33
Glu79His 0.25 —
Cys81Leu 0.09 Ser80 (catalytic), 0.33; Gly83, 0.35
His103Val 0.37 —
Asn104Ala 0.50 Ser105, 0.41
Gly176Ser 0.23 Ser177, 0.39; Leu178, 0.49
Lys236Met 0.23 Leu237, 0.46

To identify whether the substitutions in HNL6V altered the flexibility of some regions of the protein more than others, we compared the normalized B factors at the Cα atoms in HNL6V with each of the 18 comparison structures. The B factors in the HNL6V structure (mean of 27.1 Å2) are higher than they are in the 18 comparison HbHNL structures (mean of 12.7 Å2). This difference is likely to be due to the different experimental conditions associated with solving the different structures. To compare the B factors between proteins, we normalized the B factors to Z-scores. A Z-score of zero corresponds to an average B factor for that protein, while a value of 1 corresponds to a B factor one standard deviation higher than average. Thus, this normalization identifies regions that are more or less flexible than average.

The average difference in Z-score at each Cα position between HNL6V and each of the 18 comparison wild-type HbHNL structures (Fig. 4[link]) is −0.02σ ± 0.8. A value near zero is expected since the Z-score normalized the B factors for each protein to an average value of zero. Differences in B factors are mostly small (less than ±1σ) and occur throughout the protein, but especially at the 186 residues that are exposed to the solvent. (The 70 buried residues were defined as those having less than 23 Å2 solvent-exposed area.) The largest changes occur in the lid (or cap) domain (residues 115–178). The seven substitution positions showed slightly higher than average B-factor differences of +0.3σ ± 0.5.

[Figure 4]
Figure 4
The largest increases in B factors (normalized as Z-scores) for the Cα atoms in HNL6V compared with 18 wild-type HbHNL structures occur in the lid domain (residues 108–179, marked by a black horizontal line at Z-score = −1). Changes occur mostly among the 186 surface residues (thick gray vertical lines below the plotted data). The blue line shows the mean difference accross 18 pairwise comparisons of the HNL6V structure with one of the 18 wild-type HbHNL structures. The light red area shows ±1 standard deviation of the differences and the light blue area shows the full range (min to max). The red arrows mark the substitution positions and the red circles mark the catalytic triad and oxyanion-hole residues.

Among the five catalytic amino-acid residues, Asp207 and His235 in the catalytic triad show higher relative B factors by almost one standard deviation (+0.8σ ± 0.4 and +0.6σ ± 0.3, respectivly) and the oxyanion residue Leu12 and the catalytic serine 80 show lower relative B factors by about half of a standard deviation (−0.6σ ± 0.3 and −0.4σ ± 0.3, respectively). The oxyanion-hole residue Leu81 shows little change (−0.1σ ± 0.3). Substitutions in HNL6V primarily increase flexibility in the lid domain and at specific catalytic residues, with the overall B-factor differences remaining small and concentrated in surface-exposed regions.

4. Conclusions

The crystal structure of HNL6V reveals that seven amino-acid substitutions, modeled after residues in the esterase SABP2 and located within and outside the substrate-binding site, induce modest but significant shifts in backbone positions and catalytic atom locations relative to wild-type HbHNL, moving them closer to those of SABP2 while preserving the overall α/β-hydrolase fold. These substitutions also increase local flexibility, particularly in the lid domain and at certain catalytic residues, although overall structural changes remain small.

5. Related literature

The following references are cited in the supporting information for this article: Madeira et al. (2024View full citation) and Sievers et al. (2011View full citation).

Footnotes

‡These authors should be considered co-first authors.

Acknowledgements

We thank Professor Dr Helmut Schwab (Technische Universität Graz, Austria) for sharing the plasmid pSE420 containing the DNA (774 base pairs) encoding the wild-type H. brasiliensis hydroxynitrile lyase and Dr Guillem Casadevall, Dr Javier Iglesias and Professor Sílvia Osuna for computationally designing the HNL6V variant.

Conflict of interest

There authors declare no conflicts of interest.

Funding information

The following funding is acknowledged: National Institutes of Health (grant No. R35 GM119483; grant No. R35 GM118047; grant No. P30 GM124165; grant No. S10 RR029205); National Science Foundation (award No. CBET-2039039); US Department of Energy, Office of Science (contract No. DE-AC02-06CH11357).

References

Return to citationBauer, T. L., Buchholz, P. C. F. & Pleiss, J. (2020). FEBS J. 287, 1035–1053.  CrossRef PubMed Google Scholar
Return to citationBracco, P., Busch, H., von Langermann, J. & Hanefeld, U. (2016). Org. Biomol. Chem. 14, 6375–6389.  CrossRef CAS PubMed Google Scholar
Return to citationDadashipour, M. & Asano, Y. (2011). ACS Catal. 1, 1121–1149.  CrossRef CAS Google Scholar
Return to citationDadashipour, M., Fukuta, Y. & Asano, Y. (2011). Protein Expr. Purif. 77, 92–97.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationDevamani, T., Rauwerdink, A. M., Lunzer, M., Jones, B. J., Mooney, J. L., Tan, M. A. O., Zhang, Z.-J., Xu, J.-H., Dean, A. M. & Kazlauskas, R. J. (2016). J. Am. Chem. Soc. 138, 1046–1056.  CrossRef CAS PubMed Google Scholar
Return to citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationForouhar, F., Yang, Y., Kumar, D., Chen, Y., Fridman, E., Park, S. W., Chiang, Y., Acton, T. B., Montelione, G. T., Pichersky, E., Klessig, D. F. & Tong, L. (2005). Proc. Natl Acad. Sci. USA, 102, 1773–1778.  Web of Science CrossRef PubMed CAS Google Scholar
Return to citationGartler, G., Kratky, C. & Gruber, K. (2007). J. Biotechnol. 129, 87–97.  CrossRef PubMed CAS Google Scholar
Return to citationGasteiger, E., Hoogland, C., Gattiker, A., Duvaud, S., Wilkins, M. R., Appel, R. D. & Bairoch, A. (2005). The Proteomics Protocols Handbook, edited by J. M. Walker, pp. 571–607. Totowa: Humana Press.  Google Scholar
Return to citationGruber, K., Gartler, G., Krammer, B., Schwab, H. & Kratky, C. (2004). J. Biol. Chem. 279, 20501–20510.  CrossRef PubMed CAS Google Scholar
Return to citationGruber, K., Gugganig, M., Wagner, U. G. & Kratky, C. (1999). Biol. Chem. 380, 993–1000.  Web of Science CrossRef PubMed CAS Google Scholar
Return to citationHasslacher, M., Schall, M., Hayn, M., Griengl, H., Kohlwein, S. D. & Schwab, H. (1996). J. Biol. Chem. 271, 5884–5891.  CrossRef CAS PubMed Google Scholar
Return to citationJones, B. J., Evans, R. L., Mylrea, N. J., Chaudhury, D., Luo, C., Guan, B., Pierce, C. T., Gordon, W. R., Wilmot, C. M. & Kazlauskas, R. J. (2020). PLoS One, 15, e0235341.  CrossRef PubMed Google Scholar
Return to citationLanfranchi, E., Steiner, K., Glieder, A., Hajnal, I., Sheldon, R. A., van Pelt, S. & Winkler, M. (2013). Recent Pat. Biotechnol. 7, 197–206.  CrossRef CAS PubMed Google Scholar
Return to citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
Return to citationMadeira, F., Madhusoodanan, N., Lee, J., Eusebi, A., Niewielska, A., Tivey, A. R. N., Lopez, R. & Butcher, S. (2024). Nucleic Acids Res. 52, W521–W525.  Web of Science CrossRef PubMed Google Scholar
Return to citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationNedrud, D. M., Lin, H., Lopez, G., Padhi, S. K., Legatt, G. A. & Kazlauskas, R. J. (2014). Chem. Sci. 5, 4265–4277.  CrossRef CAS PubMed Google Scholar
Return to citationOchman, H., Gerber, A. S. & Hartl, D. L. (1988). Genetics, 120, 621–623.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationOllis, D. L., Cheah, E., Cygler, M., Dijkstra, B. W., Frolow, F., Franken, S. M., Harel, M., Remington, S. J., Silman, I., Schrag, J. D., Sussman, J. L., Verschueren, K. H. G. & Goldman, A. (1992). Protein Eng. Des. Sel. 5, 197–211.  CrossRef CAS Google Scholar
Return to citationOtwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationRauwerdink, A., Lunzer, M., Devamani, T., Jones, B., Mooney, J., Zhang, Z.-J., Xu, J.-H., Kazlauskas, R. J. & Dean, A. M. (2016). Mol. Biol. Evol. 33, 971–979.  CrossRef CAS PubMed Google Scholar
Return to citationSchmidt, A., Gruber, K., Kratky, C. & Lamzin, V. S. (2008). J. Biol. Chem. 283, 21827–21836.  Web of Science CrossRef PubMed CAS Google Scholar
Return to citationSievers, F., Wilm, A., Dineen, D., Gibson, T. J., Karplus, K., Li, W., Lopez, R., McWilliam, H., Remmert, M., Söding, J., Thompson, J. D. & Higgins, D. G. (2011). Mol. Syst. Biol. 7, 539.  Web of Science CrossRef PubMed Google Scholar
Return to citationWagner, U. G., Hasslacher, M., Griengl, H., Schwab, H. & Kratky, C. (1996). Structure, 4, 811–822.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationZuegg, J., Gruber, K., Gugganig, M., Wagner, U. G. & Kratky, C. (1999). Protein Sci. 8, 1990–2000.  Web of Science CrossRef PubMed CAS Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds