research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Preliminary X-ray diffraction and ligand-binding analyses of the N-terminal domain of hypothetical protein Rv1421 from Mycobacterium tuberculosis H37Rv

crossmark logo

aDepartment of Clinical Laboratory Science, College of Health Sciences, Catholic University of Pusan, Busan 46252, Republic of Korea, bNext-Generation Industrial Field-Based Specialist Program for Molecular Diagnostics, Brain Busan 21 Plus Project, Graduate School, Catholic University of Pusan, Busan 46252, Republic of Korea, and cAjou Energy Science Research Center, Ajou University, Suwon 16499, Republic of Korea
*Correspondence e-mail: [email protected]

Edited by K. K. Kim, Sungkyunkwan University School of Medicine, Republic of Korea (Received 24 May 2024; accepted 15 June 2024; online 27 June 2024)

Mycobacterium tuberculosis can reside and persist in deep tissues; latent tuberculosis can evade immune detection and has a unique mechanism to convert it into active disease through reactivation. M. tuberculosis Rv1421 (MtRv1421) is a hypothetical protein that has been proposed to be involved in nucleotide binding-related metabolism in cell-growth and cell-division processes. However, due to a lack of structural information, the detailed function of MtRv1421 remains unclear. In this study, a truncated N-terminal domain (NTD) of MtRv1421, which contains a Walker A/B-like motif, was purified and crystallized using PEG 400 as a precipitant. The crystal of MtRv1421-NTD diffracted to a resolution of 1.7 Å and was considered to belong to either the C-centered monoclinic space group C2 or the I-centered orthorhombic space group I222, with unit-cell parameters a = 124.01, b = 58.55, c = 84.87 Å, β = 133.12° or a = 58.53, b = 84.86, c = 90.52 Å, respectively. The asymmetric units of the C2 or I222 crystals contained two or one monomers, respectively. In terms of the binding ability of MtRv1421-NTD to various ligands, uridine diphosphate (UDP) and UDP-N-acetylglucosamine significantly increased the melting temperature of MtRv1421-NTD, which indicates structural stabilization through the binding of these ligands. Altogether, the results reveal that a UDP moiety may be required for the interaction of MtRv1421-NTD as a nucleotide-binding protein with its ligand.

1. Introduction

Tuberculosis (TB), which is characterized by an acute disease course and asymptomatic latent infection, is caused by Mycobacterium tuberculosis and represents a leading cause of morbidity and mortality worldwide (Parrish et al., 1998[Parrish, N. M., Dick, J. D. & Bishai, W. R. (1998). Trends Microbiol. 6, 107-112.]; Bagcchi, 2023[Bagcchi, S. (2023). Lancet Microbe, 4, e20.]). Asymptomatic latent infection with M. tuberculosis can persist for years in an immune-competent host, and results in the reactivation of TB in about 5–10% of latent deep-tissue infections (Parrish et al., 1998[Parrish, N. M., Dick, J. D. & Bishai, W. R. (1998). Trends Microbiol. 6, 107-112.]; Flynn & Chan, 2001[Flynn, J. L. & Chan, J. (2001). Infect. Immun. 69, 4195-4201.]; Balázsi et al., 2008[Balázsi, G., Heath, A. P., Shi, L. & Gennaro, M. L. (2008). Mol. Syst. Biol. 4, 225.]). M. tuberculosis undergoes a non­replicating period in macrophage phagocytes until it reactivates from latency due to reduced host immunity, which initiates the disease (Schnappinger et al., 2003[Schnappinger, D., Ehrt, S., Voskuil, M. I., Liu, Y., Mangan, J. A., Monahan, I. M., Dolganov, G., Efron, B., Butcher, P. D., Nathan, C. & Schoolnik, G. K. (2003). J. Exp. Med. 198, 693-704.]). The unique cell envelope of M. tuberculosis may be part of a defense mechanism that allows it to resist phagocytosis by the host (Lemassu & Daffé, 1994[Lemassu, A. & Daffé, M. (1994). Biochem. J. 297, 351-357.]). However, the various adaptation mechanisms of the M. tuberculosis cell envelope against environmental changes in the host are still unclear. Therefore, understanding the key factors involved in these bacterial host-adaptation mechanisms may offer a basis for the development of novel therapeutics.

M. tuberculosis Rv1421 (MtRv1421) is a hypothetical protein that has been proposed to be involved in nucleotide binding-related metabolism in cell-growth and cell-division processes (Foulquier et al., 2020[Foulquier, E., Pompeo, F., Byrne, D., Fierobe, H.-P. & Galinier, A. (2020). Sci. Rep. 10, 15938.]; Jeong et al., 2023[Jeong, Y. C., Park, J., Cheon, Y. J. & Lee, K. S. (2023). Appl. Biol. Chem. 66, 82.]). Bacillus subtilis YvcJ (BsYvcJ) and Escherichia coli RapZ (EcRapZ), as orthologous proteins to MtRv1421, are involved in the nucleotide-sugar metabolism that is required for peptido­glycan (PG) synthesis (Luciano et al., 2009[Luciano, J., Foulquier, E., Fantino, J. R., Galinier, A. & Pompeo, F. (2009). J. Bacteriol. 191, 1556-1564.]; Resch et al., 2013[Resch, M., Göpel, Y., Görke, B. & Ficner, R. (2013). Acta Cryst. F69, 109-114.]; Gonzalez et al., 2017[Gonzalez, G. M., Durica-Mitic, S., Hardwick, S. W., Moncrieffe, M. C., Resch, M., Neumann, P., Ficner, R., Görke, B. & Luisi, B. F. (2017). Nucleic Acids Res. 45, 10845-10860.]). PG synthesis is initiated from uridine diphosphate N-acetylglucosamine (UDP-GlcNAc), which is synthesized in the cytosol via the hexosamine biosynthetic pathway (Typas et al., 2012[Typas, A., Banzhaf, M., Gross, C. A. & Vollmer, W. (2012). Nat. Rev. Microbiol. 10, 123-136.]; Galinier et al., 2023[Galinier, A., Delan-Forino, C., Foulquier, E., Lakhal, H. & Pompeo, F. (2023). Biomolecules, 13, 720.]). In the first step of this pathway, fructose 6-phosphate and glutamine are converted to glucosamine 6-phosphate (GlcN6P) in a reaction catalyzed by GlcN6P synthetase (GlmS). Finally, UDP-GlcNAc is produced by the conversion of GlcN6P through this pathway, which is regulated by the intracellular concentrations of GlcN6P and UDP-GlcNAc (Foulquier et al., 2020[Foulquier, E., Pompeo, F., Byrne, D., Fierobe, H.-P. & Galinier, A. (2020). Sci. Rep. 10, 15938.]). At high intracellular concentrations of GlcN6P and UDP-GlcNAc in B. subtilis, GlcN6P binds to the ribozyme of the glmS transcript and stimulates its self-cleavage (Foulquier et al., 2020[Foulquier, E., Pompeo, F., Byrne, D., Fierobe, H.-P. & Galinier, A. (2020). Sci. Rep. 10, 15938.]; Galinier et al., 2023[Galinier, A., Delan-Forino, C., Foulquier, E., Lakhal, H. & Pompeo, F. (2023). Biomolecules, 13, 720.]). In E. coli the pathway contains the small regulatory RNA (sRNA) GlmZ, which stimulates translation of the mRNA encoding GlcN6P synthase. When the sRNA GlmZ binds to EcRapZ, it is inactivated through cleavage by the endoribonuclease RNaseE, thereby contributing to the regulation of glucosamine phosphate (Gonzalez et al., 2017[Gonzalez, G. M., Durica-Mitic, S., Hardwick, S. W., Moncrieffe, M. C., Resch, M., Neumann, P., Ficner, R., Görke, B. & Luisi, B. F. (2017). Nucleic Acids Res. 45, 10845-10860.]). Interestingly, the N-terminal domains (NTDs) of BsYvcJ and EcRapZ contain a Walker A/B motif with a phosphate-binding loop that participates in the binding of nucleotides (Saraste et al., 1990[Saraste, M., Sibbald, P. R. & Wittinghofer, A. (1990). Trends Biochem. Sci. 15, 430-434.]). The Walker A motif consists of the pattern GX4GK(TS), in which the lysine residue is involved in nucleotide binding. The Walker B motif is located downstream of the Walker A motif and has a DXXG sequence (Luciano et al., 2009[Luciano, J., Foulquier, E., Fantino, J. R., Galinier, A. & Pompeo, F. (2009). J. Bacteriol. 191, 1556-1564.]). Previous studies have reported that the Walker A/B motif of BsYvcJ induces conformational changes by binding to ATP, which protects proteins from cleavage by endoproteases (Luciano et al., 2009[Luciano, J., Foulquier, E., Fantino, J. R., Galinier, A. & Pompeo, F. (2009). J. Bacteriol. 191, 1556-1564.]).

M. tuberculosis, like B. subtilis, possesses two conserved consecutive genes, Rv1421 and Rv1422 [which correspond to YvcJ and GlmR (formerly YvcK), respectively, in B. subtilis] (Foulquier et al., 2020[Foulquier, E., Pompeo, F., Byrne, D., Fierobe, H.-P. & Galinier, A. (2020). Sci. Rep. 10, 15938.]; Jeong & Lee, 2020[Jeong, Y. C. & Lee, K. S. (2020). Acta Cryst. F76, 314-319.]; Jeong et al., 2023[Jeong, Y. C., Park, J., Cheon, Y. J. & Lee, K. S. (2023). Appl. Biol. Chem. 66, 82.]), that are involved in regulating the activity of GlmS, which catalyzes the production of UDP-GlcNAc as a cytoplasmic precursor of peptidoglycan (Sperber & Herman, 2017[Sperber, A. M. & Herman, J. K. (2017). J. Bacteriol. 199, e00039-17.]; Foulquier et al., 2020[Foulquier, E., Pompeo, F., Byrne, D., Fierobe, H.-P. & Galinier, A. (2020). Sci. Rep. 10, 15938.], Liang et al., 2021[Liang, C., Rios-Miguel, A. B., Jarick, M., Neurgaonkar, P., Girard, M., François, P., Schrenzel, J., Ibrahim, E. S., Ohlsen, K. & Dandekar, T. (2021). Microorganisms, 9, 2148.]). However, compared with BsYvcJ, the sequence identity of MtRv1421 is approximately 42%. This indicates that there is a need for further investigations into the biochemical functions of MtRv1421 in order to improve the understanding of the host-adaptation mechanism of M. tuberculosis at the molecular level. As a first step towards elucidating the structure of MtRv1421, it was truncated to the NTD containing the nucleotide-binding motif. In the present study, we report a high-resolution X-ray diffraction data set obtained from an MtRv1421-NTD crystal and its ligand-binding ability as determined by protein thermal shift analysis.

2. Materials and methods

2.1. Expression and purification of the protein

The NTD, consisting of residues 1–174, of MtRv1421 (with a total of 301 residues) was designed based on the NTD (residues 1–152) of the orthologous protein EcRapZ (Gonzalez et al., 2017[Gonzalez, G. M., Durica-Mitic, S., Hardwick, S. W., Moncrieffe, M. C., Resch, M., Neumann, P., Ficner, R., Görke, B. & Luisi, B. F. (2017). Nucleic Acids Res. 45, 10845-10860.]). To amplify the gene encoding Rv1421-NTD from M. tuberculosis H37Rv genomic DNA, the polymerase chain reaction (PCR) was performed with the forward and reverse primers containing restriction-endonuclease sites for insertion into the vector: the NdeI site in the forward primer and the HindIII site in the reverse primer are underlined in Table 1[link]. The DNA fragments digested by NdeI and HindIII were inserted into the bacterial expression vector pET-28a(+) (Novagen, USA) to generate the plasmid pMtRv1421-NTD, which contains a 6×His tag at the N-terminus. Transformed E. coli Rosetta (DE3) cells containing pMtRv1421-NTD were grown in lysogeny broth (LB) medium with suitable antibiotics (50 µg ml−1 kanamycin and 38 µg ml−1 chloramphenicol) at 25°C until an optical density of 0.6 at 600 nm was attained. Overexpression of recombinant MtRv1421-NTD was induced by adding 0.5 mM isopropyl β-D-1-thiogalactopyranoside, followed by further growth for 18 h at 18°C. The cultured cells were centrifugated at 5000g for 20 min at 25°C for harvesting. Next, the harvested cell pellets were suspended in buffer A [50 mM Tris–HCl pH 8.0, 500 mM NaCl, 10% (v/v) glycerol] containing 1 mM phenylmethylsulfonyl fluoride before being disrupted by sonication at 4°C. The crude lysate was centrifuged at 25 000g for 20 min at 4°C. The supernatant was loaded onto a HisTrap HP column (Cytiva, USA) equilibrated in buffer A. The bound protein was eluted with a linear gradient of imidazole using buffer B [50 mM Tris–HCl pH 8.0, 500 mM NaCl, 10%(v/v) glycerol, 500 mM imidazole]. Fractions containing MtRv1421-NTD were purified to the final state by size-exclusion chromatography (SEC) using a HiPrep 16/60 Sephacryl S-200 HR column (Cytiva, USA) equilibrated with buffer consisting of 50 mM Tris–HCl pH 8.0, 150 mM NaCl, 10%(v/v) glycerol. The purified soluble fractions containing MtRv1421-NTD were pooled and concentrated to 11 mg ml−1 using an Amicon Ultra-15 centrifugal filter device (Millipore, USA). The final purified MtRv1421-NTD protein was confirmed have a purity of >95% on 15% SDS–PAGE.

Table 1
Macromolecule-production information

Source organism M. tuberculosis H37Rv
DNA source Genomic DNA
Forward primer 5′-GTTCATATGATGAACCATGCTAGGGGCGTC-3′
Reverse primer 5′-TATAAGCTTCTAGCCATCACCGCCGAAGGC-3′
Cloning vector pET-28a(+)
Expression vector pET-28a(+)
Expression host E. coli Rosetta (DE3)
NCBI Reference Sequence NP_215937.1
Complete amino-acid sequence of the construct produced MGSSHHHHHHSSGLVPRGSHMMNHARGVENRSEGGGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATRAITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEGIAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG
†Restriction-enzyme sites are underlined.
‡The extra amino acids introduced into wild-type MtRv1421-NTD by cloning are underlined.

2.2. Protein crystallization

Initial crystallization screening of MtRv1421-NTD was performed by the sitting-drop vapor-diffusion method in 96-well plates utilizing a variety of commercial screening kits such as Crystal Screen, Crystal Screen 2, PEGRx 1, PEGRx 2, Natrix, Natrix 2, SaltRx, SaltRx 2 and Index (Hampton Research, USA) at 21°C. Each 2 µl drop, consisting of protein solution and reservoir solution in equal proportions, was equilibrated against 100 µl reservoir solution. Crystals were obtained from condition 6 of PEGRx 2 (Hampton Research, USA): 0.1 M sodium citrate pH 5.0, 10% 2-propanol, 26%(w/v) polyethylene glycol (PEG) 400. To optimize the crystal-growth condition, drops consisting of 1.5 µl protein solution and 1.5 µl reservoir solution [0.1 M sodium citrate pH 5.0, 6%(v/v) 2-propanol, 16%(w/v) PEG 400] were equilibrated against 300 µl reservoir solution by the hanging-drop vapor-diffusion method using a 24-well VDXm plate (Hampton Research, USA). Table 2[link] provides detailed information on the crystallization conditions that gave the best-quality crystals.

Table 2
Crystallization conditions of diffracting crystals

Method Vapor diffusion in hanging drops
Temperature (K) 294
Protein concentration (mg ml−1) 11.5
Buffer composition of protein solution 50 mM Tris–HCl pH 8.0, 150 mM NaCl, 10% glycerol
Composition of reservoir solution 0.1 M sodium citrate pH 5.0, 6%(v/v) 2-propanol, 16%(w/v) PEG 400
Volume and ratio of drop 3 µl, 1.5:1.5 ratio
Volume of reservoir (µl) 300

2.3. Data collection and processing

To ensure consistent data collection under cryogenic conditions, the MtRv1421-NTD crystal was briefly immersed in a cryoprotectant solution consisting of 25%(v/v) ethylene glycol added to the reservoir solution. After flash-cooling to −180°C in a nitrogen-gas steam, diffraction data sets were collected from the MtRv1421-NTD crystal on beamline 7A at the Pohang Light Source (PLS), Pohang, Republic of Korea using an ADSC Quantum 270r CCD detector. The best crystal of MtRv1421-NTD diffracted to be a resolution of 1.70 Å. The diffraction data set from the MtRv1421-NTD crystal was processed via autoindexing to identify the unit cell and space group of the crystal and was scaled after integration of the indexed data using the HKL-2000 package (Otwinowski & Minor, 1997[Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307-326.]). Table 3[link] summarizes the details of data collection.

Table 3
Data-collection statistics for MtRv1421-NTD

Values in parentheses are for the highest resolution shell.

Diffraction source Beamline 7A, PLS
Wavelength (Å) 0.979
Temperature (K) 100
Detector ADSC Quantum 270r CCD
Crystal-to-detector distance (mm) 200
Rotation range per image (°) 1
Total rotation range (°) 360
Exposure time per image (s) 1
Space group I222 C2
a, b, c (Å) 58.53, 84.86, 90.52 124.01, 58.55, 84.87
α, β, γ (°) 90, 90, 90 90, 133.12, 90
Resolution range (Å) 50.0–1.70 (1.76–1.70) 50.0–1.70 (1.76–1.70)
Total No. of reflections 793400 793986
No. of unique reflections 24776 47309
Completeness (%) 97.6 (99.4) 96.4 (96.6)
Multiplicity 9.9 (6.6) 5.2 (3.5)
I/σ(I)〉 22.4 (5.0) 22.5 (3.6)
CC1/2 0.996 (0.657) 0.997 (0.473)
Rmerge (%) 6.4 (42.2) 6.0 (38.9)
Rmerge = Mathematical equationMathematical equation, where Ii(hkl) represents the observed intensity, 〈I(hkl)〉 represents the average intensity and i counts through all symmetry-related reflections.

2.4. Thermal shift assay for ligand binding

A fluorescence-based thermal shift assay was performed using an Applied Biosystems 7500 Real-Time PCR System. The reactions were prepared by distributing samples into a 0.1 ml qPCR 8-strip (Gunster, Taiwan) that was sealed with cap strips. MtRv1421-NTD protein (0.15 mg ml−1) was equilibrated in the presence or absence of 5 mM of each ligand [adenosine diphosphate (ADP), adenosine triphosphate (ATP), UDP, UDP-glucose (UDP-Glc), UDP-GlcNAc, glucose-6-phosphate (G-6-P), glucosamine (GlcN), GlcNAc and GlcN-6-phosphate (GlcN6P)] in 20 µl of a reaction mixture consisting of 0.25 M sodium phosphate pH 7.0 (Protein Thermal Shift buffer) and 2 µl of the fluorescent SYPRO Orange (Sigma–Aldrich, USA; 5000×, diluted to 100× in water). Each melting curve was programmed with the following temperature gradient: 25°C for 2 min followed by a 1°C increase per minute from 25 to 85°C and finally maintaining the temperature at 85°C for 2 min. Significant background fluorescence was not observed in the absence of protein. The fluorescence intensity (excitation and emission at 470 and 570 nm, respectively) of SYPRO Orange was analyzed to give the melting temperature (Tm) using Protein Thermal Shift Software version 1.6 (Thermo Fisher Scientific, USA).

3. Results and discussion

The gene encoding Rv1421-NTD (residues 1–174) of M. tuberculosis H37Rv was successfully cloned into the pET-28a(+) expression vector and then transformed into E. coli Rosetta (DE3) cells. Recombinant MtRv1421-NTD was purified in a two-step process using Ni2+-chelated affinity chromatography and SEC. The purified MtRv1421-NTD protein showed a single band on 15% SDS–PAGE, indicating a molecular weight of 20.8 kDa, which corresponds to the calculated molecular weight for 194 residues including the His6 tag and vector-derived sequences (20 residues as shown in Table 1[link]). The purity of the MtRv1421-NTD protein was estimated to be 95% or greater. The analysis using SEC showed a chromatogram peak for MtRv1421-NTD at an elution volume of 68.35 ml; therefore, it was predicted to be in the monomeric state (Fig. 1[link]a). Multiple sequence alignment analysis of MtRv1421-NTD with the orthologous proteins BsYvcJ and EcRapZ containing a Walker A [GX4GK(TS)]/B (DXXG) motif showed that the lysine of the Walker A motif and the glycine of the Walker B motif were replaced by Arg30 and Ser78, respectively, in MtRv1421-NTD (Fig. 1[link]b). This finding suggests that MtRv1421-NTD has a Walker A (GX4GRG)/B (DXXS)-like motif that may be involved in the binding of nucleotides, similar to the Walker A/B motif.

[Figure 1]
Figure 1
Purification of Rv1421-NTD and comparison with orthologous proteins. (a) SEC and 15% SDS–PAGE analyses of purified MtRv1421-NTD. The elution peak was observed at an elution volume of 68.35 ml and was expected to correspond to a monomer. 15% SDS–PAGE stained using Coomassie Blue stain; lane 1, molecular-weight markers (labeled in kDa); lane 2, purified MtRv1421-NTD (20.8 kDa). (b) Multiple sequence alignment of MtRv1421-NTD with EcRapZ-NTD and BsYvcJ-NTD as orthologous P-loop-containing proteins. The residues involved in the Walker A and B motifs are marked with red and blue boxes, respectively. The colored labels serve to distinguish the various residue types: red, hydrophobic; green, polar; blue, acidic; magenta, basic. The symbols used in the protein sequence alignments are asterisks for identical residues, colons for conserved residues and dots for semi-conserved residues.

Crystals of MtRv1421-NTD were obtained within 7–10 days by the hanging-drop vapor-diffusion method using optimized reservoir solution consisting of 0.1 M sodium citrate pH 5.0, 6%(v/v) 2-propanol, 16%(w/v) PEG 400. The dimensions of a thick rod-shaped MtRv1421-NTD crystal were approximately 0.05 × 0.05 × 0.3 mm (Fig. 2[link]a). A diffraction data set was collected from an MtRv1421-NTD crystal to a resolution limit of 1.70 Å (Fig. 2[link]b). The results of the autoindexing process of X-ray diffraction images suggested two types of space group: C-centered monoclinic or I-centered orthorhombic. The former is the monoclinic space group C2, with unit-cell parameters a = 124.01, b = 58.55, c = 84.87 Å, α = γ = 90, β = 133.12°, containing two monomers in the asymmetric unit, which correspond to a Matthews coefficient VM and solvent content of 2.7 Å3 Da−1 and 54.41%, respectively (Kantardjieff & Rupp, 2003[Kantardjieff, K. A. & Rupp, B. (2003). Protein Sci. 12, 1865-1871.]). The latter is the ortho­rhombic space group I222, with unit-cell parameters a = 58.53, b = 84.86, c = 90.52 Å, α = β = γ = 90°, containing one monomer in the asymmetric unit, which corresponds to a Matthews coefficient VM and solvent content of 2.7 Å3 Da−1 and 54.38%, respectively (Kantardjieff & Rupp, 2003[Kantardjieff, K. A. & Rupp, B. (2003). Protein Sci. 12, 1865-1871.]). The value of the β angle of the unit cell is an important factor in determining the possibility of twinning or phase transition to the orthorhombic space group, and I-centered with the β angle close to 90° has been reported to be preferable over C-centered (Mighell, 2002[Mighell, A. D. (2002). J. Res. Natl Inst. Stand. Technol. 107, 373-377.]). However, I222 yielded a higher value for Rmerge than C2 in the scaling procedure (Table 3[link]). Despite this background, we tried to find phasing solutions in both C2 and I222 by molecular replacement with Phaser-MR in Phenix (Echols et al., 2012[Echols, N., Grosse-Kunstleve, R. W., Afonine, P. V., Bunkóczi, G., Chen, V. B., Headd, J. J., McCoy, A. J., Moriarty, N. W., Read, R. J., Richardson, D. C., Richardson, J. S., Terwilliger, T. C. & Adams, P. D. (2012). J. Appl. Cryst. 45, 581-586.]) using the crystal structure of EcRapZ (PDB entry 5o5q; Gonzalez et al., 2017[Gonzalez, G. M., Durica-Mitic, S., Hardwick, S. W., Moncrieffe, M. C., Resch, M., Neumann, P., Ficner, R., Görke, B. & Luisi, B. F. (2017). Nucleic Acids Res. 45, 10845-10860.]) as a search model. Unfortunately, none of our attempts yielded distinct solutions in either space group. To solve the phasing problem, ongoing studies will use crystals in which methionine is replaced with selenomethionine (SeMet), after which it will be possible to attempt structural determination of MtRv1421-NTD by SAD phasing.

[Figure 2]
Figure 2
Crystal and X-ray diffraction patterns of MtRv1421-NTD. (a) The crystal dimensions of MtRv1421-NTD are approximately 0.05 × 0.05 × 0.3 mm for the thick rod-shaped crystal. (b) X-ray diffraction image of an MtRv1421-NTD crystal. The red box shows an enlarged view of the area containing high-resolution spots, where a resolution shell can be seen at 1.7 Å.

PG, which is the main component of the cell wall, consists of a three-dimensional polymer and is continuously reconstructed for the growth and survival of bacteria (Typas et al., 2012[Typas, A., Banzhaf, M., Gross, C. A. & Vollmer, W. (2012). Nat. Rev. Microbiol. 10, 123-136.]). The PG precursor UDP-GlcNAc is synthesized through the action of various enzymes via the hexosamine biosynthesis pathway in the cytoplasm (Galinier et al., 2023[Galinier, A., Delan-Forino, C., Foulquier, E., Lakhal, H. & Pompeo, F. (2023). Biomolecules, 13, 720.]). Previous studies in B. subtilis have suggested that BsGlmR regulates the biosynthesis of PG precursors by interacting with BsYvcJ or GlmS, depending on the intracellular concentration of UDP-GlcNAc (Foulquier et al., 2020[Foulquier, E., Pompeo, F., Byrne, D., Fierobe, H.-P. & Galinier, A. (2020). Sci. Rep. 10, 15938.]). To verify the inter­actions of MtRv1421-NTD with nucleotides, nucleotide-sugars and amino-sugars, we conducted a ligand-binding assay using protein thermal shift. The ligand-binding ability of MtRv1421-NTD was estimated based on the shift of Tm in the presence or absence of ligand. Binding of GlcN, GlcNAc, GlcN6P and G-6-P to MtRv1421-NTD was not detected, but nucleotides and nucleotide-sugars such as ATP, ADP, UDP, UDP-Glc and UDP-GlcNAc increased the Tm, indicating that the binding of these ligands contributed to structural stabilization of MtRv1421-NTD (Fig. 3[link]). In particular, the ΔTm value of MtRv1421-NTD for UDP was approximately 2.7-fold and 5.8-fold higher than those for UDP-GlcNAc and UDP-Glc, respectively (Table 4[link]). These findings provide a reliable clue suggesting that MtRv1421 may be involved in the metabolic processes by which the synthesis of PG precursors is regulated. We also suggest that MtRv1421-NTD, which is a nucleotide-binding protein containing a Walker A/B-like motif, may require the presence of a UDP moiety to interact with its ligand. Further studies will involve more exhaustive trials and crystallization optimization to determine the binary structure of MtRv1421-NTD in complex with the appropriate ligands based on its ligand-binding ability.

Table 4
Melting temperatures (Tm) of MtRv1421-NTD interacting with various ligands

  Tm (°C) ΔTm (°C)
MtRv1421-NTD 58.36 ± 0.15  
With ligands (each at 5 mM)
 GlcN 58.50 ± 0.12 0.14 ± 0.12
 GlcNAc 58.69 ± 0.20 0.33 ± 0.20
 G-6-P 58.75 ± 0.24 0.39 ± 0.24
 GlcN6P 58.67 ± 0.17 0.31 ± 0.17
 ATP 59.69 ± 0.53 1.33 ± 0.53
 ADP 61.31 ± 0.56 2.95 ± 0.56
 UDP 67.62 ± 0.17 9.26 ± 0.17
 UDP-Glc 59.96 ± 0.32 1.60 ± 0.32
 UDP-GlcNAc 61.84 ± 0.31 3.48 ± 0.31
[Figure 3]
Figure 3
Ligand-binding ability of MtRv1421-NTD. (a) GlcN and GlcNAc, (b) G-6-P and GlcN6P, (c) ATP, (d) ADP and UDP and (e) UDP-Glu and UDP-GlcNAc. The plots of the difference in fluorescence versus temperature were obtained using a real-time PCR system based on four replicate reactions with and without ligands. The median derivative Tm values are indicated as black dotted vertical lines. A final concentration of 0.15 mg ml−1 MtRv1421-NTD was mixed with a ligand (each at 5 mM) along with the Protein Thermal Shift dye.

Acknowledgements

The authors declare that they have no competing interests. We would like to thank the staff of beamline 7A at the PLS, Pohang Accelerator Laboratory, Republic of Korea for their assistance during X-ray diffraction data collection.

Funding information

This study was supported by a National Research Foundation of Korea (NRF) grant funded by the Ministry of Science and ICT (MSIT; No. 2021R1F1A1047349). This research was supported by BB21plus funded by Busan Metropolitan City and Busan Techno Park.

References

First citationBagcchi, S. (2023). Lancet Microbe, 4, e20.  CrossRef PubMed Google Scholar
First citationBalázsi, G., Heath, A. P., Shi, L. & Gennaro, M. L. (2008). Mol. Syst. Biol. 4, 225.  PubMed Google Scholar
First citationEchols, N., Grosse-Kunstleve, R. W., Afonine, P. V., Bunkóczi, G., Chen, V. B., Headd, J. J., McCoy, A. J., Moriarty, N. W., Read, R. J., Richardson, D. C., Richardson, J. S., Terwilliger, T. C. & Adams, P. D. (2012). J. Appl. Cryst. 45, 581–586.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFlynn, J. L. & Chan, J. (2001). Infect. Immun. 69, 4195–4201.  Web of Science CrossRef PubMed CAS Google Scholar
First citationFoulquier, E., Pompeo, F., Byrne, D., Fierobe, H.-P. & Galinier, A. (2020). Sci. Rep. 10, 15938.  CrossRef PubMed Google Scholar
First citationGalinier, A., Delan-Forino, C., Foulquier, E., Lakhal, H. & Pompeo, F. (2023). Biomolecules, 13, 720.  CrossRef PubMed Google Scholar
First citationGonzalez, G. M., Durica-Mitic, S., Hardwick, S. W., Moncrieffe, M. C., Resch, M., Neumann, P., Ficner, R., Görke, B. & Luisi, B. F. (2017). Nucleic Acids Res. 45, 10845–10860.  CrossRef CAS PubMed Google Scholar
First citationJeong, Y. C. & Lee, K. S. (2020). Acta Cryst. F76, 314–319.  CrossRef IUCr Journals Google Scholar
First citationJeong, Y. C., Park, J., Cheon, Y. J. & Lee, K. S. (2023). Appl. Biol. Chem. 66, 82.  CrossRef Google Scholar
First citationKantardjieff, K. A. & Rupp, B. (2003). Protein Sci. 12, 1865–1871.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLemassu, A. & Daffé, M. (1994). Biochem. J. 297, 351–357.  CrossRef CAS PubMed Google Scholar
First citationLiang, C., Rios-Miguel, A. B., Jarick, M., Neurgaonkar, P., Girard, M., François, P., Schrenzel, J., Ibrahim, E. S., Ohlsen, K. & Dandekar, T. (2021). Microorganisms, 9, 2148.  CrossRef PubMed Google Scholar
First citationLuciano, J., Foulquier, E., Fantino, J. R., Galinier, A. & Pompeo, F. (2009). J. Bacteriol. 191, 1556–1564.  Web of Science CrossRef PubMed CAS Google Scholar
First citationMighell, A. D. (2002). J. Res. Natl Inst. Stand. Technol. 107, 373–377.  Web of Science CrossRef CAS PubMed Google Scholar
First citationOtwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326.  CrossRef CAS PubMed Web of Science Google Scholar
First citationParrish, N. M., Dick, J. D. & Bishai, W. R. (1998). Trends Microbiol. 6, 107–112.  Web of Science CrossRef CAS PubMed Google Scholar
First citationResch, M., Göpel, Y., Görke, B. & Ficner, R. (2013). Acta Cryst. F69, 109–114.  CrossRef IUCr Journals Google Scholar
First citationSaraste, M., Sibbald, P. R. & Wittinghofer, A. (1990). Trends Biochem. Sci. 15, 430–434.  CrossRef PubMed Web of Science Google Scholar
First citationSchnappinger, D., Ehrt, S., Voskuil, M. I., Liu, Y., Mangan, J. A., Monahan, I. M., Dolganov, G., Efron, B., Butcher, P. D., Nathan, C. & Schoolnik, G. K. (2003). J. Exp. Med. 198, 693–704.  CrossRef PubMed CAS Google Scholar
First citationSperber, A. M. & Herman, J. K. (2017). J. Bacteriol. 199, e00039-17.  CrossRef PubMed Google Scholar
First citationTypas, A., Banzhaf, M., Gross, C. A. & Vollmer, W. (2012). Nat. Rev. Microbiol. 10, 123–136.  CrossRef CAS Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds