research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
ADDENDA AND ERRATA

A correction has been published for this article. To view the correction, click here.

Crystal structure of a short-chain de­hydrogenase from Burkholderia cenocepacia J2315 in complex with NADP+ and benzoic acid

crossmark logo

aThe Hormel Institute, University of Minnesota, Austin, MN 55912, USA, bDepartment of Chemistry and Biochemistry, University of Maryland Baltimore County, Baltimore, MD 21250, USA, cUCB BioSciences, Bainbridge Island, WA 98110, USA, dSeattle Structural Genomics Center for Infectious Disease (SSGCID), Seattle, WA 98105, USA, eDepartment of Natural Sciences, Albany State University, Albany, GA 31707, USA, fCollege of Health Professions, Nursing and Pharmacy, Manchester University, North Manchester, IN 46962, USA, gDepartment of Chemistry and Biochemistry, Hampton University, Hampton, VA 23668, USA, hDepartment of Integrative Biology, Oklahoma State University, Stillwater, OK 74078, USA, iDepartment of Biological Sciences, College of the Sequoias, Visalia, CA 93277, USA, jDepartment of Microbiology, Immunology and Molecular Genetics, University of California Los Angeles, Los Angeles, CA 90095, USA, kBiological and Chemical Sciences Department, Manhattan University, Bronx, NY 10471, USA, lCollege of Natural Sciences and Mathematics, Lenoir-Rhyne University, Hickory, NC 28601, USA, mDepartment of Chemistry, Clemson University, Clemson, SC 29634, USA, nState University of New York at Cortland, Cortland, NY 13045, USA, and oDepartment of Chemistry, Ithaca College, Ithaca, NY 14850, USA
*Correspondence e-mail: [email protected], [email protected], [email protected]

Edited by O. Asojo, Dartmouth College, USA (Received 3 October 2024; accepted 19 November 2024; online 30 November 2024)

This article is part of a focused issue on empowering education through structural genomics.

Burkholderia cenocepacia is an opportunistic human pathogen that can cause lethal infections in immunocompromised individuals, particularly those with cystic fibrosis. As such, there is a critical need to identify and characterize the structure and function of enzymes that participate in the metabolic pathways of this bacterium. Here, the high-resolution X-ray crystal structure of a short-chain dehydrogenase reductase (SDR) from B. cenocepacia J2315 (BcSDR) in complex with the coenzyme NADP+ and a benzoic acid ligand is presented. This protein has the conserved Rossmann fold of the SDR superfamily and the characteristic TGxxxGxG motif of the classical SDR subfamily. However, unlike classical SDRs, the active site of BcSDR has a leucine residue in place of the highly conserved and catalytically important tyrosine residue. Sequence analysis confirms that this leucine residue is conserved in this SDR across the Burkholderiales order. This suggests that BcSDR is more appropriately classified into the divergent SDR subfamily. In addition, this enzyme would necessarily employ a different enzyme mechanism to that proposed as a general mechanism for most SDRs.

1. Introduction

Burkholderia cenocepacia is a Gram-negative bacterium that is known to be a human pathogen. Due to its inherent antibiotic resistance, ability to form biofilms and virulence factors, this organism is often responsible for life-threatening infections in immunocompromised patients (O'Grady & Sokol, 2011[O'Grady, E. P. & Sokol, P. A. (2011). Front. Cell. Infect. Microbiol. 1, 15.]; Scoffone et al., 2016[Scoffone, V. C., Chiarelli, L. R., Makarov, V., Brackman, G., Israyilova, A., Azzalin, A., Forneris, F., Riabova, O., Savina, S., Coenye, T., Riccardi, G. & Buroni, S. (2016). Sci. Rep. 6, 32487.]). Nosocomial infections caused by this organism are often spread through contaminated medical devices and between patients (Holden et al., 2009[Holden, M. T., Seth-Smith, H. M., Crossman, L. C., Sebaihia, M., Bentley, S. D., Cerdeño-Tárraga, A. M., Thomson, N. R., Bason, N., Quail, M. A., Sharp, S., Cherevach, I., Churcher, C., Goodhead, I., Hauser, H., Holroyd, N., Mungall, K., Scott, P., Walker, D., White, B., Rose, H., Iversen, P., Mil-Homens, D., Rocha, E. P., Fialho, A. M., Baldwin, A., Dowson, C., Barrell, B. G., Govan, J. R., Vandamme, P., Hart, C. A., Mahenthiralingam, E. & Parkhill, J. (2009). J. Bacteriol. 191, 261-277.]; Mann et al., 2010[Mann, T., Ben-David, D., Zlotkin, A., Shachar, D., Keller, N., Toren, A., Nagler, A., Smollan, G., Barzilai, A. & Rahav, G. (2010). Infection, 38, 187-194.]; Sass et al., 2011[Sass, A., Marchbank, A., Tullis, E., LiPuma, J. J. & Mahenthiralingam, E. (2011). BMC Genomics, 12, 373.]). It is particularly harmful in cystic fibrosis patients, where it can cause respiratory infections that are difficult to treat and often fatal (Lauman & Dennis, 2021[Lauman, P. & Dennis, J. J. (2021). Viruses, 13, 1331.]; Lipuma, 2010[LiPuma, J. J. (2010). Clin. Microbiol. Rev. 23, 299-323.]). The particular challenges in treating infections arising from B. cenocepacia arise from the natural and acquired resistance of this organism to antibiotics and the multiple resistance mechanisms that it employs (Scoffone et al., 2017[Scoffone, V. C., Chiarelli, L. R., Trespidi, G., Mentasti, M., Riccardi, G. & Buroni, S. (2017). Front. Microbiol. 8, 1592.]). To better understand molecular mechanisms of pathogenicity and to aid in the development of new treatments, the primary mission of the Seattle Structural Genomics Center for Infectious Disease (SSGCID) is to determine the 3D atomic structures of proteins and other molecules with important biological roles in human pathogens. Here, we describe the crystal structure of a B. cenocepacia short-chain dehydro­genase reductase (BcSDR). SDRs are a large family of NAD(P)-dependent oxidoreductases that catalyse a wide range of reactions, such as carbonyl–alcohol oxidoreductions (Fig. 1[link]a). This superfamily is found in all domains of life and performs critical metabolic transformations on diverse substrates including carbohydrates, lipids, amino acids, hormones and many others (Kavanagh et al., 2008[Kavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895-3906.]). Typically, SDRs employ a conserved tyrosine residue in the dehydro­genase mechanism (Fig. 1[link]b).

[Figure 1]
Figure 1
SDR chemistry. SDRs are NAD(P)-dependent oxido­reductases that catalyse a wide range of reactions, including carbonyl–alcohol oxido­reductions as shown in (a). Most SDRs have some variation of a YxxxK active-site motif. The highly conserved tyrosine residue acts as the putative active-site base in the proposed SDR mechanism (b).

SDRs play important roles in varying biological processes, including hormonal signaling and regulation, detoxification of xenobiotics, lipid homeostasis and a range of metabolic functions (Kavanagh et al., 2008[Kavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895-3906.]; Mo et al., 2020[Mo, X., Zhang, H., Du, F. & Yang, S. (2020). Front. Microbiol. 11, 610827.]; Oppermann & Maser, 2000[Oppermann, U. C. & Maser, E. (2000). Toxicology, 144, 71-81.]). Because of their substrate breadth and their capability to reduce C=O and C=C bonds, SDRs have also shown promise as biocatalysts (Beerens et al., 2021[Beerens, K., Gevaert, O. & Desmet, T. (2021). Front. Mol. Biosci. 8, 784142.]; Borg et al., 2021[Borg, A. J. E., Beerens, K., Pfeiffer, M., Desmet, T. & Nidetzky, B. (2021). Curr. Opin. Chem. Biol. 61, 43-52.]; Roth et al., 2020[Roth, S., Stockinger, P., Steff, J., Steimle, S., Sautner, V., Tittmann, K., Pleiss, J. & Müller, M. (2020). ChemBioChem, 21, 2615-2619.]). The structure described here is of an NADP-dependent SDR that is putatively involved in the metabolism of benzoic acid or its precursors. In addition to providing a basis for future drug development, the bacterial metabolism of benzoate has additional implications for human health. Because of the broad use of sodium benzoate as a food preservative, microbial benzoate catabolism by gut microbiota may influence other metabolic processes and overall human physiology (Yadav et al., 2021[Yadav, M., Lomash, A., Kapoor, S., Pandey, R. & Chauhan, N. S. (2021). Sci. Rep. 11, 5561.]).

2. Materials and methods

2.1. Macromolecule production

Cloning, expression and purification followed standard protocols as described previously (Bryan et al., 2011[Bryan, C. M., Bhandari, J., Napuli, A. J., Leibly, D. J., Choi, R., Kelley, A., Van Voorhis, W. C., Edwards, T. E. & Stewart, L. J. (2011). Acta Cryst. F67, 1010-1014.]; Choi et al., 2011[Choi, R., Kelley, A., Leibly, D., Nakazawa Hewitt, S., Napuli, A. & Van Voorhis, W. (2011). Acta Cryst. F67, 998-1005.]; Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]). The full-length gene for the putative short-chain dehydrogenase reductase (SDR) from B. cenocepacia J2315 (BcSDR; UniProt B4EFS5) encoding amino acids 1–237 was PCR-amplified from genomic DNA using the primers shown in Table 1[link]. The gene was ligation-independently cloned into pBG1861 (Alexandrov et al., 2004[Alexandrov, A., Vignali, M., LaCount, D. J., Quartley, E., de Vries, C., De Rosa, D., Babulski, J., Mitchell, S. F., Schoenfeld, L. W., Fields, S., Hol, W. G. J., Dumont, M. E., Phizicky, E. M. & Grayhack, E. J. (2004). Mol. Cell. Proteomics, 3, 934-938.]), encoding a noncleavable N-terminal 6×His-tag. Plasmid DNA was transformed into chemically competent cells. The plasmid containing His-BcSDR was tested for expression and 2 l of culture was grown using auto-induction medium (Studier, 2005[Studier, F. W. (2005). Protein Expr. Purif. 41, 207-234.]) in a LEX Bioreactor (Epiphyte Three) as described previously (Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]).

Table 1
Macromolecule-production information

Source organism Burkholderia cenocepacia (strain J2315)
DNA source Jane L. Burns, Seattle Children's Pediatrics
Forward primer 5′-CTCACCACCACCACCACCATATGGTGGCTTACGATCTTCAGGGCAAATTGAAGGCTGCGTGGC-3′
Reverse primer 5′-ATCCTATCTTACTCACTTAAGGCGTCAAAAGGCGCGCG-3′
Expression vector† pBG1861
Expression host Escherichia coli BL21(DE3) R3 Rosetta
Complete amino-acid sequence of the construct produced MAHHHHHHMQIEGCVACVTGADRGLGAGLLEALLERGARKVYAGVRKKECLSDVGPRVVPVEIDITNVEQVARAASRAKDITLLINNAGLNRMQPVLEAHDPEAARAEMEVNYFGTLNMMRAFSPALKSNGGAIINVLSILARVALPSMASLSASKAAALRMTEGARAELAPHRVRVISVLPGPIDTEMSRNVPPPKIAVREAVDAVLAALEGGADEVYMGAMAQEIAQGLAADRQALHARLLTP
†The expression clone and purified protein are available at https://targetstatus.ssgcid.org/Target/BuceA.00010.y.

His-BcSDR was purified in a two-step protocol consisting of an immobilized metal (Ni2+) affinity chromatography (IMAC) step followed by size-exclusion chromatography (SEC). All chromatography runs were performed on an ÄKTApurifier 10 (GE Healthcare) using automated IMAC and SEC programs (Bryan et al., 2011[Bryan, C. M., Bhandari, J., Napuli, A. J., Leibly, D. J., Choi, R., Kelley, A., Van Voorhis, W. C., Edwards, T. E. & Stewart, L. J. (2011). Acta Cryst. F67, 1010-1014.]). Thawed bacterial pellets (∼25 g) were lysed by sonication in 200 ml buffer consisting of 25 mM HEPES pH 7.4, 300 mM NaCl, 5%(v/v) glycerol, 30 mM imidazole, 0.5%(w/v) CHAPS, 10 mM MgCl2, 3 mM β-mercaptoethanol, 1.3 mg ml−1 protease-inhibitor cocktail (Roche, Basel, Switzerland), 0.05 mg ml−1 lysozyme. After sonication, the crude lysate was clarified with 20 ml (25 units µl−1) of Benzonase and incubated while mixing at room temperature for 45 min. The lysate was clarified by centrifugation at 10 000 rev min−1 for 1 h using a Sorvall centrifuge (Thermo Scientific). The clarified supernatant was then passed over an Ni–NTA His-Trap FF 5 ml column (GE Healthcare) which had been pre-equilibrated with loading buffer consisting of 25 mM HEPES pH 7.0, 300 mM NaCl, 5%(v/v) glycerol, 30 mM imidazole, 1 mM DTT. The column was washed with 20 column volumes (CV) of loading buffer and was eluted with loading buffer plus 500 mM imidazole in a linear gradient over 7 CV. Peak fractions were pooled and concentrated to 5 ml. A SEC column (Superdex 75, GE Healthcase) was equilibrated with running buffer consisting of 25 mM HEPES pH 7.0, 300 mM NaCl, 5%(v/v) glycerol, 1 mM TCEP. The peak fractions were collected and analyzed for the protein of interest using SDS–PAGE. These fractions were then pooled and concentrated to 46.9 mg ml−1 using an Amicon purification system (Millipore). Aliquots of 200 µl were flash-frozen in liquid nitrogen and stored at −80°C until use.

2.2. Crystallization

Initial crystallization trials were conducted using the sitting-drop vapor-diffusion method with the JCSG+ commercial crystallization screen (Rigaku Reagents). Each drop consisted of a mixture of 0.4 µl 23.45 mg ml−1 protein solution, 0.4 µl well solution and a final concentration of 5 mM NADP+. Crystals of BcSDR were obtained in screen condition C6 consisting of 40% PEG 300, 100 mM sodium phosphate dibasic/citric acid pH 4.2. A single crystal was directly vitrified, without additional cryoprotectant, by plunging it into liquid nitrogen prior to data collection. To facilitate phase determination by single-wavelength anomalous dispersion (SAD), a single crystal was incubated in reservoir solution supplemented with 10% 5 M sodium iodide in ethylene glycol, giving final concentrations of 500 mM sodium iodide and 10% ethylene glycol, for 30 s prior to vitrification by plunge-freezing in liquid nitrogen. Additional crystallization data can be found in Table 2[link].

Table 2
Crystallization

Method Vapor diffusion, sitting drop
Temperature (K) 290
Protein concentration (mg ml−1) 23.45
Buffer composition of protein solution 20 mM HEPES pH 7.0, 300 mM NaCl, 5% glycerol, 1 mM TCEP
Composition of reservoir solution Rigaku Reagents JCSG+ screen C6: 40% PEG 300, 0.1 M sodium phosphate dibasic/citric acid pH 4.2
Volume and ratio of drop 0.4 µl protein + 0.4 µl reservoir (1:1)
Volume of reservoir (µl) 80

2.3. Data collection and processing

X-ray diffraction data were collected at 100 K on the LS-CAT beamline 21-ID-G at the Advanced Photon Source (APS) using a Rayonix MX-300 detector. Data were integrated using XDS and reduced with XSCALE (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]). Data for phasing were collected at 100 K using a Cu Kα rotating-anode (1.5418 Å) home source and a Rigaku Saturn 944+ detector. Additional data-collection information is provided in Table 3[link]. The raw images and detailed data-collection information are available for download at https://proteindiffraction.org/search/?q=5u4s.

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source 21-ID-G, APS
Wavelength (Å) 0.97856
Temperature (K) 100
Detector Rayonix MX-300 CCD
Space group P212121
a, b, c (Å) 39.27, 75.66, 146.01
α, β, γ (°) 90, 90, 90
Resolution range (Å) 50.0–1.40 (1.44–1.40)
Total No. of reflections 494506
No. of unique reflections 86241
Completeness (%) 99.5 (94.7)
Multiplicity 5.73 (3.61)
〈I/σ(I)〉 13.91 (2.12)
Rr.i.m† 0.079 (0.637)
Overall B factor from Wilson plot (Å2) 12.61
†Estimated Rr.i.m. = Rmerge [N/(N − 1)]1/2, where N is the data multiplicity.

2.4. Structure solution and refinement

The structure of BcSDR was solved by SAD phasing using data collected from crystals soaked with sodium iodide (Abendroth et al., 2011[Abendroth, J., Gardberg, A. S., Robinson, J. I., Christensen, J. S., Staker, B. L., Myler, P. J., Stewart, L. J. & Edwards, T. E. (2011). J. Struct. Funct. Genomics, 12, 83-95.]). The phases were determined with Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) and an initial model was partially built using ARP/wARP (Perrakis et al., 1999[Perrakis, A., Morris, R. & Lamzin, V. S. (1999). Nat. Struct. Biol. 6, 458-463.]). The model was then improved through iterative rounds of model refinement using Phenix (Liebschner et al., 2019[Liebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861-877.]) and manual model building with Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). Refinement statistics are provided in Table 4[link]. The final model was deposited in the Protein Data Bank as entry 5u4s.

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 50.00–1.40 (1.44–1.40)
Completeness (%) 99.5
σ Cutoff F > 1.350σ(F)
No. of reflections, working set 86226
No. of reflections, test set 1984
Final Rcryst 0.148 (0.236)
Final Rfree 0.166 (0.255)
No. of non-H atoms
 Protein 3469
 Ligand 119
 Water 450
 Total 4038
R.m.s. deviations
 Bond lengths (Å) 0.008
 Angles (°) 1.076
Average B factor (Å2) 12.61
Ramachandran plot
 Most favored (%) 98
 Allowed (%) 2

3. Results and discussion

B. cenocepacia SDR (BcSDR) crystallized in an orthorhombic space group (P212121) with two molecules per asymmetric unit. The crystals had a solvent content of 41.1%, with a Matthews coefficient of 2.09 Å3 Da−1. The native data, collected on the 21-ID-G beamline at the Advanced Photon Source, were of good quality, with diffraction to 1.4 Å resolution. Because of the relatively low sequence similarity to other known structures (<32% sequence identity), experimental phasing was carried out using SAD data collected using a Cu Kα source from crystals soaked with sodium iodide (Abendroth et al., 2011[Abendroth, J., Gardberg, A. S., Robinson, J. I., Christensen, J. S., Staker, B. L., Myler, P. J., Stewart, L. J. & Edwards, T. E. (2011). J. Struct. Funct. Genomics, 12, 83-95.]). Additional data-collection and structure-solution details are provided in Tables 3[link] and 4[link].

The protomer of BcSDR has the Rossmann fold characteristic of this family of proteins, with a central parallel β-sheet flanked by α-helices on each side (Fig. 2[link]a). The overall structure was observed to be homodimeric, with a phosphate ion present at the dimer interface (Fig. 2[link]b). While it is possible that the phosphate ion co-purified with the protein, it is likely to be present due to the crystallization conditions, which contained 100 mM phosphate. Analysis using PDBePISA (Krissinel & Henrick, 2007[Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774-797.]) confirms the assignment of the dimer as the most stable complex, with a buried surface area between chains A and B of 11 150 Å2. This observation is consistent with BcSDR being part of the classical SDR subclass, the members of which are predominantly dimeric or tetrameric in structure (Kavanagh et al., 2008[Kavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895-3906.]).

[Figure 2]
Figure 2
Overall structure of BcSDR. The protomer of BcSDR has a central β-sheet flanked by α-helices on each side (a) with NADP+ (ball-and-stick representation) bound in the cofactor-binding site and benzoic acid (wire representation) bound in the active site. α-Helices are shown in blue, β-sheets are shown in green and loops are shown in yellow. NADP+ and benzoic acid are depicted with green C atoms, red O atoms, blue N atoms and orange P atoms. The active form of BcSDR is a dimer (b). Chain A, NADP+ and benzoic acid are colored as in (a). Chain B is colored red.

SDRs are known to be NAD(P)-dependent enzymes. The structure of BcSDR showed clear electron density for NADP+ in the coenzyme-binding site in both chains (Fig. 3[link]a). NADP+-binding SDRs are governed by the presence of a basic residue within the glycine-rich coenzyme-binding motif (Kavanagh et al., 2008[Kavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895-3906.]). They also can have a basic residue at the first position after β-strand 2 (Kallberg et al., 2002[Kallberg, Y., Oppermann, U., Jörnvall, H. & Persson, B. (2002). Eur. J. Biochem. 269, 4409-4417.], 2010[Kallberg, Y., Oppermann, U. & Persson, B. (2010). FEBS J. 277, 2375-2386.]). BcSDR has the conserved TGxxxGxG motif (Fig. 4[link]) representative of the classical SDR subfamily. The Asp14 and Arg15 residues within this motif, as well as the nearby Arg38, make key hydrogen-bonding interactions with the phosphate of NADP (Fig. 3[link]b). In this case, Arg15 is the basic residue within the glycine-rich motif, while Arg38 is the basic residue at the first position after β-strand 2. The NAD-dependent SDRs also tend to have a more enclosed coenzyme-binding region, with a nearby helix and loop structure occupying the space where the phosphate would bind, thereby imparting a sterically selective force for NAD binding (Fig. 3[link]c).

[Figure 3]
Figure 3
Coenzyme-binding site. The electron density (2Fo − Fc, contoured at 1.5σ) around the NADP+ cofactor (a) is well resolved and clearly matches NADP+ (NADP in chain A is shown). Several key hydrogen-bonding interactions (b) are made between the Asp14, Arg15 and Arg38 residues of BcSDR and the phosphate moiety of NADP+. Here, C atoms are shown in green, O atoms in red, N atoms in blue and P atoms in orange. As demonstrated by superposition of BcSDR with an NAD-binding SDR (c) (PDB entry 5u8p, shown in pink with pink C atoms), residues (Leu115 and Glu118 of PDB entry 5u8p) of a nearby loop and helix provide a sterically selective force for binding NAD versus NADP. This helix that harbors Glu118 in PDB entry 5u8p is absent in BcSDR and would clash with Arg38. Note that further details about the goodness of fit of the coenzyme, including additional maps and images, can be found in the PDB validation report for PDB entry 5u4s.
[Figure 4]
Figure 4
Sequence alignment of BcSDR with other NADP-binding SDRs. A sequence alignment of BcSDR (PDB entry 5u4s) with Homo sapiens 17-β-hydroxysteroid dehydrogenase (PDB entry 1a27, 30.15% sequence identity to PDB entry 5u4s; Mazza, 1997[Mazza, C. (1997). PhD thesis. Université Joseph Fourier, Grenoble, France.]), Mus musculus carbonyl reductase (PDB entry 1cyd, 32.82% identity; Tanaka et al., 1996[Tanaka, N., Nonaka, T., Nakanishi, M., Deyashiki, Y., Hara, A. & Mitsui, Y. (1996). Structure, 4, 33-45.]), Escherichia coli serine dehydrogenase (PDB entry 3asu, 27.42% identity; Yamazawa et al., 2011[Yamazawa, R., Nakajima, Y., Mushiake, K., Yoshimoto, T. & Ito, K. (2011). J. Biochem. 149, 701-712.]) and Leishmania major pteridine reductase (PDB entry 1e7w, 25.69% identity; Gourley et al., 2001[Gourley, D. G., Schüttelkopf, A. W., Leonard, G. A., Luba, J., Hardy, L. W., Beverley, S. M. & Hunter, W. N. (2001). Nat. Struct. Biol. 8, 521-525.]) is shown. The green triangles show the NADP-binding sequence motif and the orange triangles show the active-site sequence motif. This figure was prepared with ESPript 3.0 (Robert & Gouet, 2014[Robert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320-W324.]).

In addition to the coenzyme, BcSDR co-crystallized with a molecule of benzoic acid bound in the active site (Figs. 5[link]a and 5[link]b). Benzoic acid was not added during crystallization, nor was it present in any of the media or purification buffers. This suggests that this molecule is likely to be representative of the native ligand structure. The benzoic acid in the BcSDR structure is stabilized by hydrogen bonds to Asn83, Ser131 and two water molecules (Fig. 5[link]a). Catalysis in the substrate-binding domain typically involves a YxxxK sequence motif in helix 5 and upstream asparagine and serine amino-acid residues. The tyrosine residue in this motif is highly, but not strictly, conserved and is the catalytic base in the majority of SDRs (Kavanagh et al., 2008[Kavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895-3906.]). BcSDR is one of the few exceptions to this rule, and instead has an LxxxK motif (Fig. 4[link]). The tyrosine residue in this conserved motif is believed to be part of the catalytic tetrad Asn–Ser–Tyr–Lys characteristic of SDRs. The tyrosine residue putatively initiates the proton transfer to the substrate in the proposed mechanism (Filling et al., 2002[Filling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677-25684.]). In the structure of BcSDR, a leucine residue (Leu144) and a well ordered water molecule are present at the position that the conserved tyrosine would typically occupy (Fig. 5[link]b). As the leucine residue would be unable to function similarly to the tyrosine, this observation suggests that BcSDR employs a different catalytic mechanism to that currently proposed for other SDRs. In this case, it is likely that either Ser131 or Asn83 would act as the base (Fig. 5[link]c). Further studies are needed to fully elucidate the mechanism of BcSDR. To ensure that this sequence is not an artifact, or unique to this particular subspecies, we conducted a BLAST search (Altschul et al., 1990[Altschul, S. F., Gish, W., Miller, W., Myers, E. W. & Lipman, D. J. (1990). J. Mol. Biol. 215, 403-410.]), using the sequence of BcSDR, across the Burkholderiales class. Our results (Fig. 6[link]) indicate that this LxxxK motif is conserved across a wide range of species, which indicates that this tyrosine-to-leucine substitution is not unique to this subspecies and could be a functionally relevant difference that distinguishes this class of organism. Despite BcSDR having an oligomeric structure and a coenzyme-binding motif that are suggestive of a classical SDR, the unusual active-site residues indicate that this protein is more appropriately classified as a divergent SDR (Kallberg et al., 2010[Kallberg, Y., Oppermann, U. & Persson, B. (2010). FEBS J. 277, 2375-2386.]; Kavanagh et al., 2008[Kavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895-3906.]).

[Figure 5]
Figure 5
Active site of BcSDR. The active site of BcSDR (yellow C atoms) in complex with benzoic acid (green C atoms) is shown in (a). Water molecules are represented as red spheres. Hydrogen bonds are illustrated with black lines and bond distances are given in Å. O atoms are shown in red and N atoms are shown in blue. BcSDR and a B. multivorans SDR with the active-site Leu144 (yellow) and Tyr159 (pink) residues overlaid (b) reveal a similar environment between the water molecule and the O atom of Tyr159. Because BcSDR does not have the conserved tyrosine of classical SDRs, it is likely that Ser131 or Asn83 (c) would act as the general base in the enzyme mechanism.
[Figure 6]
Figure 6
Alignment of several SDR sequences from the order Burkholderiales. An alignment of ten SDR sequences from different Burkholderiales bacteria with that of BcSDR shows a high degree of sequence conservation. The active site, highlighted with orange triangles, shows that the LxxxK motif observed in BcSDR is common among other members of Burkholderiales and is distinct from the canonical SDR motif.

A structural similarity search using the DALI server (Holm et al., 2023[Holm, L., Laiho, A., Törönen, P. & Salgado, M. (2023). Protein Sci. 32, e4519.]) revealed proteins predominantly annotated as SDRs as the top hits with similarity to BcSDR (Table 5[link]). An overlay of BcSDR and the top four proteins from the DALI search shows, as expected, a high degree of overall structural conservation, with some differences observed in the active-site cavity (Fig. 7[link]). This structural variety in the active site is characteristic of the broad range of substrates acted upon by SDRs. The results of the structure-similarity search using BcSDR are consistent with the inherent substrate variability within this protein family. Amongst the top hits are dehydrogenases that bind linear alcohols (2,3-butanediol), sugar alcohols (galactitol), sulfonates (hydroxypropylethane thiosulfonate), β-lactams (clavulanic acid), steroids (estradiol) and prosthetic groups on proteins (acyl carrier protein).

Table 5
Results of a DALI search using the structure of BcSDR (June 2024)

PDB code Z-score† R.m.s.d.‡ (Å) % ID§ Description Organism
6vsp 29.8 2.1 22 2,3-Butanediol dehydrogenase Serratia marcescens
1nff 29.0 2.3 27 Putative oxidoreductase RV2002 Mycobacterium tuberculosis
2jah 29.0 1.8 29 Clavulanic acid dehydrogenase Streptomyces clavuligerus
4nbu 28.9 1.9 26 3-Oxoacyl-(acyl-carrier-protein) reductase Bacillus sp. SG-1
6d9y 28.8 1.9 23 Short-chain dehydrogenase Paraburkholderia phymatum STM815
3p19 28.6 1.8 26 Putative blue fluorescent protein Vibrio vulnificus
8y11 28.6 1.9 21 SDR-family reductase Herbaspirillum huttiense
2cfc 28.6 1.8 27 2-(R)-Hydroxypropylethane thiosulfonate dehydrogenase Xanothobacter autotrophicus Py2
3lqf 28.5 1.8 29 Galactitol dehydrogenase Cereibacter sphaeroides
5ig2 28.4 2.4 23 Short-chain dehydrogenase Paraburkholderia phymatum STM815
4cqm 27.9 1.8 22 Estradiol 17-β-dehydrogenase 8 Homo sapiens
†Calculated Z-score for alignment.
‡Root-mean-square deviation.
§Percentage sequence identity between BcSDR and the listed protein.
[Figure 7]
Figure 7
Superposition of BcSDR on its four closest structural homologs. The active-site cavity is defined by a space-filled representation of benzoic acid. The superimposed proteins (BcSDR in blue, PDB entry 6vsp from Serratia marcescens in black, PDB entry 1nff from Mycobacterium tuberculosis in cyan, PDB entry 2jah from Streptomyces clavuligerus in tan and PDB entry 4nbu from Bacillus sp. SG-1 in orange; Javidpour et al., 2014[Javidpour, P., Pereira, J. H., Goh, E. B., McAndrew, R. P., Ma, S. M., Friedland, G. D., Keasling, J. D., Chhabra, S. R., Adams, P. D. & Beller, H. R. (2014). Appl. Environ. Microbiol. 80, 497-505.]; MacKenzie et al., 2007[MacKenzie, A. K., Kershaw, N. J., Hernandez, H., Robinson, C. V., Schofield, C. J. & Andersson, I. (2007). Biochemistry, 46, 1523-1533.]; Subramanian et al., 2020[Subramanian, V., Lunin, V. V., Farmer, S. J., Alahuhta, M., Moore, K. T., Ho, A., Chaudhari, Y. B., Zhang, M., Himmel, M. E. & Decker, S. R. (2020). Biotechnol. Biofuels, 13, 186.]; Yang et al., 2003[Yang, J. K., Park, M. S., Waldo, G. S. & Suh, S. W. (2003). Proc. Natl Acad. Sci. USA, 100, 455-460.]) demonstrate the overall structural similarity and highlight the differences in the substrate-binding cavities necessary for these SDRs to catalyse their distinct chemistries.

4. Conclusion

The structure reported here expands our understanding of SDR enzymes and provides a valuable structural framework for future studies of the role that this enzyme plays in the life cycle of B. cenocepacia. Despite having the classical SDR fold and the conserved coenzyme-binding domain, the distinct active-site architecture of BcSDR suggest that this protein is most appropriately classed as a divergent SDR. Further studies will be needed to better understand how this enzyme can catalyse a dehydrogenase reaction in the absence of the highly conserved tyrosine residue.

Acknowledgements

This work is a combined effort from the students and faculty involved in the Molecular Interactions Virtual Research Experiences for Undergraduates (MIV-REU) program, in collaboration with the SSGCID. The authors would like to thank Emily Goff, Gabrielle Paaverud and Jenna Lau for their invaluable assistance with the administration and evaluation of the MIV-REU program.

Biographical information

[link]

[Scheme 1]
Early career author: Kafi K. J. Belfon.

Funding information

SSGCID is funded by Federal funds from the National Institute of Allergy and Infectious Diseases (NIAID), National Institutes of Health (NIH), Department of Health and Human Services under Contract No. 75N93022C00036. SSGCID was funded under NIAID Contract Nos. HHSN272201700059C from 1 September 2017 through 31 August 2022, HHSN272201200025C from 1 September 2012 through 31 August 2017 and HHSN272200700057C from 28 September 2007 through 27 September 2012. Student researchers were part of the Molecular Interactions Virtual REU (MIV-REU) program funded by the National Science Foundation under grant Nos. 2149978 (JBF, KAH and ATT), 2050740 (KAH), 2051087 (JBF and ATT) and 2042704 (JBF).

References

First citationAbendroth, J., Gardberg, A. S., Robinson, J. I., Christensen, J. S., Staker, B. L., Myler, P. J., Stewart, L. J. & Edwards, T. E. (2011). J. Struct. Funct. Genomics, 12, 83–95.  CrossRef CAS PubMed Google Scholar
First citationAlexandrov, A., Vignali, M., LaCount, D. J., Quartley, E., de Vries, C., De Rosa, D., Babulski, J., Mitchell, S. F., Schoenfeld, L. W., Fields, S., Hol, W. G. J., Dumont, M. E., Phizicky, E. M. & Grayhack, E. J. (2004). Mol. Cell. Proteomics, 3, 934–938.  Web of Science CrossRef PubMed CAS Google Scholar
First citationAltschul, S. F., Gish, W., Miller, W., Myers, E. W. & Lipman, D. J. (1990). J. Mol. Biol. 215, 403–410.  CrossRef CAS PubMed Web of Science Google Scholar
First citationBeerens, K., Gevaert, O. & Desmet, T. (2021). Front. Mol. Biosci. 8, 784142.  CrossRef PubMed Google Scholar
First citationBorg, A. J. E., Beerens, K., Pfeiffer, M., Desmet, T. & Nidetzky, B. (2021). Curr. Opin. Chem. Biol. 61, 43–52.  CrossRef CAS PubMed Google Scholar
First citationBryan, C. M., Bhandari, J., Napuli, A. J., Leibly, D. J., Choi, R., Kelley, A., Van Voorhis, W. C., Edwards, T. E. & Stewart, L. J. (2011). Acta Cryst. F67, 1010–1014.  Web of Science CrossRef IUCr Journals Google Scholar
First citationChoi, R., Kelley, A., Leibly, D., Nakazawa Hewitt, S., Napuli, A. & Van Voorhis, W. (2011). Acta Cryst. F67, 998–1005.  Web of Science CrossRef IUCr Journals Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFilling, C., Berndt, K. D., Benach, J., Knapp, S., Prozorovski, T., Nordling, E., Ladenstein, R., Jörnvall, H. & Oppermann, U. (2002). J. Biol. Chem. 277, 25677–25684.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGourley, D. G., Schüttelkopf, A. W., Leonard, G. A., Luba, J., Hardy, L. W., Beverley, S. M. & Hunter, W. N. (2001). Nat. Struct. Biol. 8, 521–525.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHolden, M. T., Seth-Smith, H. M., Crossman, L. C., Sebaihia, M., Bentley, S. D., Cerdeño-Tárraga, A. M., Thomson, N. R., Bason, N., Quail, M. A., Sharp, S., Cherevach, I., Churcher, C., Goodhead, I., Hauser, H., Holroyd, N., Mungall, K., Scott, P., Walker, D., White, B., Rose, H., Iversen, P., Mil-Homens, D., Rocha, E. P., Fialho, A. M., Baldwin, A., Dowson, C., Barrell, B. G., Govan, J. R., Vandamme, P., Hart, C. A., Mahenthiralingam, E. & Parkhill, J. (2009). J. Bacteriol. 191, 261–277.  CrossRef PubMed CAS Google Scholar
First citationHolm, L., Laiho, A., Törönen, P. & Salgado, M. (2023). Protein Sci. 32, e4519.  Web of Science CrossRef PubMed Google Scholar
First citationJavidpour, P., Pereira, J. H., Goh, E. B., McAndrew, R. P., Ma, S. M., Friedland, G. D., Keasling, J. D., Chhabra, S. R., Adams, P. D. & Beller, H. R. (2014). Appl. Environ. Microbiol. 80, 497–505.  Web of Science CrossRef PubMed Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKallberg, Y., Oppermann, U., Jörnvall, H. & Persson, B. (2002). Eur. J. Biochem. 269, 4409–4417.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKallberg, Y., Oppermann, U. & Persson, B. (2010). FEBS J. 277, 2375–2386.  Web of Science CrossRef CAS PubMed Google Scholar
First citationKavanagh, K. L., Jörnvall, H., Persson, B. & Oppermann, U. (2008). Cell. Mol. Life Sci. 65, 3895–3906.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKrissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774–797.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLauman, P. & Dennis, J. J. (2021). Viruses, 13, 1331.  CrossRef PubMed Google Scholar
First citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
First citationLiPuma, J. J. (2010). Clin. Microbiol. Rev. 23, 299–323.  CrossRef PubMed Google Scholar
First citationMacKenzie, A. K., Kershaw, N. J., Hernandez, H., Robinson, C. V., Schofield, C. J. & Andersson, I. (2007). Biochemistry, 46, 1523–1533.  Web of Science CrossRef PubMed CAS Google Scholar
First citationMann, T., Ben-David, D., Zlotkin, A., Shachar, D., Keller, N., Toren, A., Nagler, A., Smollan, G., Barzilai, A. & Rahav, G. (2010). Infection, 38, 187–194.  CrossRef CAS PubMed Google Scholar
First citationMazza, C. (1997). PhD thesis. Université Joseph Fourier, Grenoble, France.  Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMo, X., Zhang, H., Du, F. & Yang, S. (2020). Front. Microbiol. 11, 610827.  CrossRef PubMed Google Scholar
First citationO'Grady, E. P. & Sokol, P. A. (2011). Front. Cell. Infect. Microbiol. 1, 15.  PubMed Google Scholar
First citationOppermann, U. C. & Maser, E. (2000). Toxicology, 144, 71–81.  Web of Science CrossRef PubMed CAS Google Scholar
First citationPerrakis, A., Morris, R. & Lamzin, V. S. (1999). Nat. Struct. Biol. 6, 458–463.  Web of Science CrossRef PubMed CAS Google Scholar
First citationRobert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320–W324.  Web of Science CrossRef CAS PubMed Google Scholar
First citationRoth, S., Stockinger, P., Steff, J., Steimle, S., Sautner, V., Tittmann, K., Pleiss, J. & Müller, M. (2020). ChemBioChem, 21, 2615–2619.  CrossRef CAS PubMed Google Scholar
First citationSass, A., Marchbank, A., Tullis, E., LiPuma, J. J. & Mahenthiralingam, E. (2011). BMC Genomics, 12, 373.  Google Scholar
First citationScoffone, V. C., Chiarelli, L. R., Makarov, V., Brackman, G., Israyilova, A., Azzalin, A., Forneris, F., Riabova, O., Savina, S., Coenye, T., Riccardi, G. & Buroni, S. (2016). Sci. Rep. 6, 32487.  CrossRef PubMed Google Scholar
First citationScoffone, V. C., Chiarelli, L. R., Trespidi, G., Mentasti, M., Riccardi, G. & Buroni, S. (2017). Front. Microbiol. 8, 1592.  CrossRef PubMed Google Scholar
First citationSerbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594–599.  Web of Science CrossRef IUCr Journals Google Scholar
First citationStudier, F. W. (2005). Protein Expr. Purif. 41, 207–234.  Web of Science CrossRef PubMed CAS Google Scholar
First citationSubramanian, V., Lunin, V. V., Farmer, S. J., Alahuhta, M., Moore, K. T., Ho, A., Chaudhari, Y. B., Zhang, M., Himmel, M. E. & Decker, S. R. (2020). Biotechnol. Biofuels, 13, 186.  CrossRef PubMed Google Scholar
First citationTanaka, N., Nonaka, T., Nakanishi, M., Deyashiki, Y., Hara, A. & Mitsui, Y. (1996). Structure, 4, 33–45.  CrossRef CAS PubMed Web of Science Google Scholar
First citationYadav, M., Lomash, A., Kapoor, S., Pandey, R. & Chauhan, N. S. (2021). Sci. Rep. 11, 5561.  CrossRef PubMed Google Scholar
First citationYamazawa, R., Nakajima, Y., Mushiake, K., Yoshimoto, T. & Ito, K. (2011). J. Biochem. 149, 701–712.  Web of Science CrossRef CAS PubMed Google Scholar
First citationYang, J. K., Park, M. S., Waldo, G. S. & Suh, S. W. (2003). Proc. Natl Acad. Sci. USA, 100, 455–460.  Web of Science CrossRef PubMed CAS Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds