research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Crystal structure of N-terminally hexahistidine-tagged Onchocerca volvulus macrophage migration inhibitory factor-1

crossmark logo

aDepartment of Clinical Laboratory Science, College of Nursing and Allied Health Sciences, Howard University, 801 North Capitol Street, 4th Floor, Washington, DC 20002, USA, bGrafton High School USA, 403 Grafton Drive, Yorktown, VA 23692, USA, cProtein Structure and X-ray Crystallography Laboratory, University of Kansas, 2034 Becker Drive, Lawrence, KS 66047, USA, dSeattle Structural Genomics Center for Infectious Diseases, Seattle, Washington, USA, eCenter for Global Infectious Disease Research, Seattle Children's Research Institute, 307 Westlake Avenue, North Suite 500, Seattle, WA 98109, USA, fNYX, New York Structural Biology Center, Upton, NY 11973, USA, gUniversity of Kansas, 2034 Becker Drive, Lawrence, KS 66218, USA, and hDartmouth Cancer Center, One Medical Center Drive, Lebanon, NH 03756, USA
*Correspondence e-mail: [email protected]

Edited by J. Agirre, University of York, United Kingdom (Received 30 August 2024; accepted 30 October 2024; online 6 November 2024)

This article is part of a focused issue on empowering education through structural genomics.

Onchocerca volvulus causes blindness, onchocerciasis, skin infections and devastating neurological diseases such as nodding syndrome. New treatments are needed because the currently used drug, ivermectin, is contraindicated in pregnant women and those co-infected with Loa loa. The Seattle Structural Genomics Center for Infectious Disease (SSGCID) produced, crystallized and determined the apo structure of N-terminally hexahistidine-tagged O. volvulus macrophage migration inhibitory factor-1 (His-OvMIF-1). OvMIF-1 is a possible drug target. His-OvMIF-1 has a unique jellyfish-like structure with a prototypical macrophage migration inhibitory factor (MIF) trimer as the `head' and a unique C-terminal `tail'. Deleting the N-terminal tag reveals an OvMIF-1 structure with a larger cavity than that observed in human MIF that can be targeted for drug repurposing and discovery. Removal of the tag will be necessary to determine the actual biological oligomer of OvMIF-1 because size-exclusion chomatographic analysis of His-OvMIF-1 suggests a monomer, while PISA analysis suggests a hexamer stabilized by the unique C-terminal tails.

1. Introduction

The filarial nematode Onchocerca volvulus causes onchocerciasis or river blindness, the second leading cause of global blindness and a neglected disease with a global disease burden of 1.23 million disability-adjusted life years (Tirados et al., 2022[Tirados, I., Thomsen, E., Worrall, E., Koala, L., Melachio, T. T. & Basáñez, M. G. (2022). Trends Parasitol. 38, 591-604.]). O. volvulus is transmitted to humans by blackflies. In addition to causing blindness and severe eye and skin diseases, O. volvulus is associated with `nodding syndrome', a serious neurological disorder (Colebunders et al., 2023[Colebunders, R., Hadermann, A. & Siewe Fodjo, J. N. (2023). PLoS Negl. Trop. Dis. 17, e0011523.]). Nodding syndrome has been reported in Tanzania, northern Uganda and South Sudan, affecting children aged 5–15 years and resulting in progressive neurological and intellectual decline, stunted growth and characteristic immunologic epilepsy (Colebunders et al., 2023[Colebunders, R., Hadermann, A. & Siewe Fodjo, J. N. (2023). PLoS Negl. Trop. Dis. 17, e0011523.]; Olum et al., 2020[Olum, S., Scolding, P., Hardy, C., Obol, J. & Scolding, N. J. (2020). Brain Commun. 2, fcaa037.]; Benedek et al., 2020[Benedek, G., Abed El Latif, M., Miller, K., Rivkin, M., Ramadhan Lasu, A. A., Riek, L. P., Lako, R., Edvardson, S., Alon, S. A., Galun, E. & Levite, M. (2020). PLoS Negl. Trop. Dis. 14, e0008436.]). Additionally, onchocerciasis causes premature mortality and morbidity and increased child mortality rates from high disease burden and onchocerciasis-related epilepsy (Van Cutsem et al., 2024[Van Cutsem, G., Siewe Fodjo, J. N., Hadermann, A., Amaral, L. J., Trevisan, C., Pion, S. & Colebunders, R. (2024). Seizure, https://doi.org/10.1016/j.seizure.2024.04.018.]; Olum et al., 2020[Olum, S., Scolding, P., Hardy, C., Obol, J. & Scolding, N. J. (2020). Brain Commun. 2, fcaa037.]; Chesnais et al., 2018[Chesnais, C. B., Nana-Djeunga, H. C., Njamnshi, A. K., Lenou-Nanga, C. G., Boullé, C., Bissek, A. Z., Kamgno, J., Colebunders, R. & Boussinesq, M. (2018). Lancet Infect. Dis. 18, 1278-1286.]).

Onchocerciasis is currently controlled with hygiene efforts and school-based mass drug administration of the antiparasitic drug ivermectin (Martin et al., 2021[Martin, R. J., Robertson, A. P. & Choudhary, S. (2021). Trends Parasitol. 37, 48-64.]; Colebunders et al., 2024[Colebunders, R., Siewe Fodjo, J. N., Kamoen, O., Amaral, L.-J., Hadermann, A., Trevisan, C., Taylor, M. J., Gauglitz, J., Hoerauf, A., Sato, Y., Polman, K., Basanez, M.-G., Bhwana, D., Lakwo, T., Abd-Elfarag, G. & Pion, S. D. (2024). Infect. Dis. Poverty, 13, 5.]; Stapley et al., 2024[Stapley, J. N., Hamley, J. I. D., Walker, M., Dixon, M. A., Colebunders, R. & Basáñez, M. G. (2024). Nat. Commun. 15, 6275.]). Ivermectin is an inexpensive drug that effectively eradicates the parasite's dermal stage (microfilariae), preventing skin damage and vision loss (Cupp et al., 2011[Cupp, E. W., Mackenzie, C. D. & Unnasch, T. R. (2011). Res. Rep. Trop. Med. 2, 81-92.]; Nikièma et al., 2018[Nikièma, A. S., Koala, L., Post, R. J., Paré, A. B., Kafando, C. M., Drabo, F., Belem, A. M. G., Dabiré, R. K. & Traoré, S. (2018). Acta Trop. 185, 176-182.]; Higazi et al., 2014[Higazi, T. B., Geary, T. G. & Mackenzie, C. D. (2014). Res. Rep. Trop. Med. 5, 77-93.]). Between 1988 and 2009, >800 million ivermectin doses were administered, significantly diminishing the prevalence of onchocerciasis in more than 25 countries and disrupting its transmission in ten countries (Cupp et al., 2011[Cupp, E. W., Mackenzie, C. D. & Unnasch, T. R. (2011). Res. Rep. Trop. Med. 2, 81-92.]; Tekle et al., 2012[Tekle, A. H., Elhassan, E., Isiyaku, S., Amazigo, U. V., Bush, S., Noma, M., Cousens, S., Abiose, A. & Remme, J. H. (2012). Parasit. Vectors, 5, 28]). Alternative therapeutic approaches are needed because ivermectin cannot eradicate adult worms, so the transmission cycle continues (Cupp et al., 2011[Cupp, E. W., Mackenzie, C. D. & Unnasch, T. R. (2011). Res. Rep. Trop. Med. 2, 81-92.]; Erber et al., 2021[Erber, A. C., Ariyo, E., Olliaro, P., Nicolas, P., Chaccour, C. & Colebunders, R. (2021). Pathogens, 10, 1588.]). O. volvulus eradication efforts are hampered by adverse reactions to ivermectin, including death, in patients who are co-infected with high levels of the nematode parasite Loa loa (Boullé et al., 2023[Boullé, C., Chesnais, C. B., Kamgno, J., Gardon, J., Chippaux, J., Ranque, S., Garcia, A., Pion, S. D. & Boussinesq, M. (2023). Lancet Microbe, 4, e93-e101.]).

Ivermectin is contraindicated in treating pregnant women because ivermectin is a known mammalian teratogen (Erber et al., 2021[Erber, A. C., Ariyo, E., Olliaro, P., Nicolas, P., Chaccour, C. & Colebunders, R. (2021). Pathogens, 10, 1588.]; Nicolas et al., 2020[Nicolas, P., Maia, M. F., Bassat, Q., Kobylinski, K. C., Monteiro, W., Rabinovich, N. R., Menendez, C., Bardaji, A. & Chaccour, C. (2020). Lancet Glob. Health, 8, e92-e100.]). The historical exclusion of pregnant women from community-based drug (ivermectin) administration programs leads to heightened maternal and infant mortality, with implications for future `parasitic tolerance' in prenatally exposed children (Nicolas et al., 2020[Nicolas, P., Maia, M. F., Bassat, Q., Kobylinski, K. C., Monteiro, W., Rabinovich, N. R., Menendez, C., Bardaji, A. & Chaccour, C. (2020). Lancet Glob. Health, 8, e92-e100.]; Colebunders et al., 2024[Colebunders, R., Siewe Fodjo, J. N., Kamoen, O., Amaral, L.-J., Hadermann, A., Trevisan, C., Taylor, M. J., Gauglitz, J., Hoerauf, A., Sato, Y., Polman, K., Basanez, M.-G., Bhwana, D., Lakwo, T., Abd-Elfarag, G. & Pion, S. D. (2024). Infect. Dis. Poverty, 13, 5.]). Furthermore, repeated ivermectin treatments may genetically select treatment-resistant adult female worms, thus negating the anti-fecundity effects of ivermectin (Tirados et al., 2022[Tirados, I., Thomsen, E., Worrall, E., Koala, L., Melachio, T. T. & Basáñez, M. G. (2022). Trends Parasitol. 38, 591-604.]; Lustigman & McCarter, 2007[Lustigman, S. & McCarter, J. P. (2007). PLoS Negl. Trop. Dis. 1, e76.]; Osei-Atweneboana et al., 2011[Osei-Atweneboana, M. Y., Awadzi, K., Attah, S. K., Boakye, D. A., Gyapong, J. O. & Prichard, R. K. (2011). PLoS Negl. Trop. Dis. 5, e998.]).

O. volvulus and other parasitic nematodes co-evolved with their hosts and are experts at surviving in hostile microenvironments, where they feed on host blood and release molecules such as macrophage migration inhibitory factor (MIF) homologs to evade or suppress host immune responses for several years without killing the host (Loukas et al., 2005[Loukas, A., Constant, S. L. & Bethony, J. M. (2005). FEMS Immunol. Med. Microbiol. 43, 115-124.]; Loukas & Prociv, 2001[Loukas, A. & Prociv, P. (2001). Clin. Microbiol. Rev. 14, 689-703.]; Rodríguez-Sosa et al., 2003[Rodríguez-Sosa, M., Rosas, L. E., David, J. R., Bojalil, R., Satoskar, A. R. & Terrazas, L. I. (2003). Infect. Immun. 71, 1247-1254.]; Vermeire et al., 2008[Vermeire, J. J., Cho, Y., Lolis, E., Bucala, R. & Cappello, M. (2008). Trends Parasitol. 24, 355-363.]). Human MIF (hMIF) is a cytokine with tautomerase activity that binds the CD74 receptor (Cho et al., 2011[Cho, Y., Vermeire, J. J., Merkel, J. S., Leng, L., Du, X., Bucala, R., Cappello, M. & Lolis, E. (2011). Chem. Biol. 18, 1089-1101.]; Vermeire et al., 2008[Vermeire, J. J., Cho, Y., Lolis, E., Bucala, R. & Cappello, M. (2008). Trends Parasitol. 24, 355-363.]). CD74 binding is necessary for the roles of hMIF in recruiting immune cells and activating cellular responses, including cell proliferation and metabolism (Bernhagen et al., 2007[Bernhagen, J., Krohn, R., Lue, H., Gregory, J. L., Zernecke, A., Koenen, R. R., Dewor, M., Georgiev, I., Schober, A., Leng, L., Kooistra, T., Fingerle-Rowson, G., Ghezzi, P., Kleemann, R., McColl, S. R., Bucala, R., Hickey, M. J. & Weber, C. (2007). Nat. Med. 13, 587-596.]; Klasen et al., 2014[Klasen, C., Ohl, K., Sternkopf, M., Shachar, I., Schmitz, C., Heussen, N., Hobeika, E., Levit-Zerdoun, E., Tenbrock, K., Reth, M., Bernhagen, J. & El Bounkari, O. (2014). J. Immunol. 192, 5273-5284.]). Parasite MIF homologs are vital for the survival and proliferation of these parasites in the host (Cho et al., 2011[Cho, Y., Vermeire, J. J., Merkel, J. S., Leng, L., Du, X., Bucala, R., Cappello, M. & Lolis, E. (2011). Chem. Biol. 18, 1089-1101.]; Vermeire et al., 2008[Vermeire, J. J., Cho, Y., Lolis, E., Bucala, R. & Cappello, M. (2008). Trends Parasitol. 24, 355-363.]). Targeting parasite MIF orthologues offers alternatives for drug development for neglected tropical diseases since some parasite MIF inhibitors have been shown to kill the parasites selectively (Cho et al., 2007[Cho, Y., Jones, B. F., Vermeire, J. J., Leng, L., DiFedele, L., Harrison, L. M., Xiong, H., Kwong, Y. K., Chen, Y., Bucala, R., Lolis, E. & Cappello, M. (2007). J. Biol. Chem. 282, 23447-23456.]).

O. volvulus and many parasitic nematodes secrete MIF homologs to facilitate evasion of the host's immune system (Rodríguez-Sosa et al., 2003[Rodríguez-Sosa, M., Rosas, L. E., David, J. R., Bojalil, R., Satoskar, A. R. & Terrazas, L. I. (2003). Infect. Immun. 71, 1247-1254.]; Vermeire et al., 2008[Vermeire, J. J., Cho, Y., Lolis, E., Bucala, R. & Cappello, M. (2008). Trends Parasitol. 24, 355-363.]). Parasite MIFs may facilitate immune evasion by altering macrophage influx, immune cell activation and host cytokine production (Falcone et al., 2001[Falcone, F. H., Loke, P., Zang, X., MacDonald, A. S., Maizels, R. M. & Allen, J. E. (2001). J. Immunol. 167, 5348-5354.]). Like their mammalian MIF counterparts, parasite MIF homologs inhibit host macrophage migration, and neutralizing antibodies can abort the inhibition (Vermeire et al., 2008[Vermeire, J. J., Cho, Y., Lolis, E., Bucala, R. & Cappello, M. (2008). Trends Parasitol. 24, 355-363.]; Pastrana et al., 1998[Pastrana, D. V., Raghavan, N., FitzGerald, P., Eisinger, S. W., Metz, C., Bucala, R., Schleimer, R. P., Bickel, C. & Scott, A. L. (1998). Infect. Immun. 66, 5955-5963.]). Parasite MIFs have tautomerase activity and catalyze the keto–enol isomerization of aromatic substrates such as hydroxyphenyl­pyruvate and L-dopachrome methyl ester (Vermeire et al., 2008[Vermeire, J. J., Cho, Y., Lolis, E., Bucala, R. & Cappello, M. (2008). Trends Parasitol. 24, 355-363.]). To clarify the structural basis of these functions, we produced, crystallized and determined the 1.9 Å resolution structure of N-terminally hexahistidine-tagged macrophage migration inhibitory factor-1 (His-OvMIF-1).

2. Materials and methods

2.1. Macromolecule production

His-OvMIF-1 was cloned, expressed and purified using established protocols (Stacy et al., 2011[Stacy, R., Begley, D. W., Phan, I., Staker, B. L., Van Voorhis, W. C., Varani, G., Buchko, G. W., Stewart, L. J. & Myler, P. J. (2011). Acta Cryst. F67, 979-984.]; Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]; Rodríguez-Hernández et al., 2023[Rodríguez-Hernández, D., Vijayan, K., Zigweid, R., Fenwick, M. K., Sankaran, B., Roobsoong, W., Sattabongkot, J., Glennon, E. K. K., Myler, P. J., Sunnerhagen, P., Staker, B. L., Kaushansky, A. & Grøtli, M. (2023). Nat. Commun. 14, 5408.]; Buchko et al., 2013[Buchko, G. W., Abendroth, J., Robinson, H., Zhang, Y., Hewitt, S. N., Edwards, T. E., Van Voorhis, W. C. & Myler, P. J. (2013). J. Struct. Funct. Genomics, 14, 47-57.]). The full-length gene for macrophage migration inhibitory factor-1 from O. volvulus (UniProt Q963F7) encoding amino acids 1–115 was codon-optimized for expression in Escherichia coli and synthesized by the gene-synthesis vendor Twist Bioscience. The codon-optimized sequence was ligated into the expression vector pET-28a to generate plasmid DNA. The final design incorporates a hexahistidine and 3C protease cleavage site for cleavage between TQ/GPGS that forms the N-terminal extension (Table 1[link]).

Table 1
Macromolecule-production information

Source organism Onchocerca volvulus
DNA source CollegeCodon optimized and synthetically generated plasmid from Twist Bioscience
Expression vector pET-28a, AVA N-terminal tag
Expression host Escherichia coli BL21(DE3) Rosetta
Complete amino-acid sequence of the construct produced† MAHHHHHHMGTLEAQTQGPGSMPAFTINTNIPQSNVSDAFLKKASSTVAKALGKPESYVAIHVNGGQAMVFGGSTDPCAVCVLKSIGCVGPNVNNSHSEKLFKLLADELKIPKNRCYIEFVNIDASTMAFNGSTFG
†The N-terminal extension is underlined and the disordered loop residues are shown in bold and underlined.

Plasmid DNA was transformed into chemically competent E. coli BL21(DE3)R3 Rosetta cells. The plasmid containing His-OvMIF-1 was tested for expression and 2 l of culture was grown using auto-induction medium (Studier, 2005[Studier, F. W. (2005). Protein Expr. Purif. 41, 207-234.]) in a LEX Bioreactor (Epiphyte Three) as described previously (Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]). The expression clone can be requested online at https://www.ssgcid.org/available-materials/expression-clones/.

His-OvMIF-1 was purified in two steps: an immobilized metal (Ni2+) affinity chromatography (IMAC) step and size-exclusion chromatography (SEC) on an AKTApurifier 10 (GE Healthcare) using automated IMAC and SEC programs (Serbzhinskiy et al., 2015[Serbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594-599.]). Briefly, thawed bacterial pellets (25 g) were lysed by sonication in 200 ml lysis buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 0.5%(w/v) CHAPS, 30 mM imidazole, 10 mM MgCl2, 1 mM TCEP, 250 mg ml−1 AEBSF, 0.025%(w/v) sodium azide]. After sonication, nucleic acids were degraded from the crude lysate by adding 20 µl (25 units ml−1) of Benzonase and incubating while mixing at room temperature for 45 min. The lysate was clarified by centrifugation at 10 000 rev min−1 for 1 h using a Sorvall centrifuge (Thermo Scientific). The clarified supernatant was then passed over an Ni–NTA HisTrap FF 5 ml column (GE Healthcare) which had been pre-equilibrated with loading buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 30 mM imidazole, 1 mM TCEP, 0.025%(w/v) sodium azide]. The column was washed with 20 column volumes (CV) of loading buffer and eluted with elution buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 30 mM imidazole, 1 mM TCEP, 0.025%(w/v) sodium azide, 250 mM imidazole] over a 7 CV linear gradient. Peak fractions were pooled, concentrated to 5 ml and loaded onto a Superdex 75 column (GE Healthcare) equilibrated with running buffer (25 mM HEPES pH 7.0, 500 mM NaCl, 5% glycerol, 2 mM DTT, 0.025% azide). His-OvMIF-1 eluted as a single/monodisperse peak at ∼19 kDa, indicating a monomer. The peak fractions were collected and analyzed using a reduced SDS–PAGE gel. Pure peak fractions were pooled and concentrated to 20 mg ml−1 using an Amicon purification system (Millipore). Aliquots of 110 µl were flash-frozen in liquid nitrogen and stored at −80°C until use. Purified His-OvMIF-1 can be requested online at https://www.ssgcid.org/available-materials/ssgcid-proteins/.

2.2. Crystallization

Purified His-OvMIF-1 includes an N-terminal extension (hexahistidine and 3C protease site; underlined in Table 1[link]), which was not removed before crystallization. His-OvMIF-1 was crystallized at 291 K using sitting-drop vapor diffusion. Briefly, 20.6 mg ml−1 protein was mixed with precipitant solution in a 1:1 ratio as described in Table 2[link]. The protein buffer was 5 mM HEPES pH 7.0, 500 mM NaCl, 5% glycerol, 2 mM DTT, 0.025% azide, while the precipitant solution was 100 mM bis-Tris–HCl pH 6.5, 400 mM sodium chloride, 30% (w/v) PEG 3350. No additional cryoprotectant was added before flash-cooling for data collection.

Table 2
Crystallization

Method Vapor diffusion, sitting drop
Plate type Tray 101-d6, 96-well plates
Temperature (K) 291
Protein concentration (mg ml−1) 20.1
Buffer composition of protein solution 25 mM HEPES pH 7.0, 500 mM NaCl, 5% glycerol, 2 mM DTT, 0.025% azide
Composition of reservoir solution 100 mM bis-Tris–HCl pH 6.5, 400 mM sodium chloride, 30%(w/v) PEG 3350
Volume and ratio of drop 0.2 µl, 1:1
Volume of reservoir (µl) 50

2.3. Data collection and processing

Table 3[link] describes the data collection. The data were integrated with XDS (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]) and reduced with AIMLESS (Evans, 2006[Evans, P. (2006). Acta Cryst. D62, 72-82.]). Raw X-ray diffraction images have been stored at the Integrated Resource for Reproducibility in Macromolecular Crystallography (https://proteindiffraction.org/project/OnvoA_00834_a_UX1-Apo_8vj2/).

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source Beamline 19-ID, NSLS-II
Temperature (K) 100
Detector Dectris EIGER2 XE 9M
Space group C2221
a, b, c (Å) 52.44, 91.13, 132.49
α, β, γ (°) 90, 90, 90
Resolution range (Å) 45.45–1.90 (1.95–1.90)
Total No. of reflections 340455 (25834)
Completeness (%) 99.9 (99.2)
Multiplicity 13.4 (14.0)
〈I/σ(I)〉 15.0 (2.1)
Rr.i.m. 0.091 (1.136)
Overall B factor from Wilson plot (Å2) 50.48

2.4. Structure solution and refinement

The structure of His-OvMIF-1 was determined by molecular replacement with Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) from the CCP4 suite of programs (Collaborative Computational Project, Number 4, 1994[Collaborative Computational Project, Number 4 (1994). Acta Cryst. D50, 760-763.]; Krissinel et al., 2004[Krissinel, E. B., Winn, M. D., Ballard, C. C., Ashton, A. W., Patel, P., Potterton, E. A., McNicholas, S. J., Cowtan, K. D. & Emsley, P. (2004). Acta Cryst. D60, 2250-2255.]; Winn et al., 2011[Winn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235-242.]; Agirre et al., 2023[Agirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449-461.]) using PDB entry 1mif (Sun et al., 1996[Sun, H. W., Bernhagen, J., Bucala, R. & Lolis, E. (1996). Proc. Natl Acad. Sci. USA, 93, 5191-5196.]) as the search model. Structure refinement and manual model building were carried out with Phenix (Liebschner et al., 2019[Liebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861-877.]) and Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]), respectively. The structure quality was checked using MolProbity (Williams et al., 2018[Williams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, J. S. (2018). Protein Sci. 27, 293-315.]). Data-reduction and refinement statistics are shown in Table 4[link]. Coordinate and structure factors have been deposited with the Worldwide PDB (wwPDB) as entry 8vj2. The structure was inspected with the CheckMyBlob server, which identified no additional blobs or ligands (https://checkmyblob.bioreproducibility.org/server/; Kowiel et al., 2019[Kowiel, M., Brzezinski, D., Porebski, P. J., Shabalin, I. G., Jaskolski, M. & Minor, W. (2019). Bioinformatics, 35, 452-461.]).

Table 4
Structure refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 45.45–1.90 (1.98–1.90)
Completeness (%) 99.3
σ Cutoff F > 1.34σ(F)
No. of reflections, working set 25255 (2549)
No. of reflections, test set 1249 (178)
Final Rcryst 0.217 (0.3317)
Final Rfree 0.236 (0.4181)
No. of non-H atoms
 Protein 2398
 Ion 1
 Ligand 0
 Water 83
 Total 2482
R.m.s. deviations
 Bond lengths (Å) 0.004
 Angles (°) 0.700
Average B factors (Å2)
 Protein 58.2
 Ion 73.9
 Ligand 0.0
 Water 46.0
Ramachandran plot
 Most favored (%) 95.9
 Allowed (%) 4.1

3. Results and discussion

The 1.9 Å resolution apo structure of His-OvMIF-1 is reported. SEC data indicate that the protein purifies as a monomer. There are three His-OvMIF-1 monomers in the asymmetric unit (Fig. 1[link]a). Unlike the molecular-replacement search model (PDB entry 1mif; human MIF, hMIF-1), His-OvMIF-1 has a unique C-terminal tail that extends outwards and makes the structure resemble a jellyfish (Fig. 1[link]b). The quality of the electron-density maps for the structure is shown in Supplementary Fig. S1. Proteins, Interfaces, Structures and Assemblies (PISA) analysis (Krissinel, 2010[Krissinel, E. (2010). J. Comput. Chem. 31, 133-143.]; Krissinel & Henrick, 2005[Krissinel, E. & Henrick, K. (2005). CompLife 2005, edited by M. R. Berthold, R. C. Glen, K. Diederichs, O. Kohlbacher & I. Fischer, pp. 163-174. Berlin, Heidelberg: Springer-Verlag.], 2007[Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774-797.]) suggests that the most stable assembly is a hexamer in which the tails form intermolecular β-strands (Fig. 1[link]e). The hexamer has a dumbbell shape, with each head of the dumbbell consisting of the classical MIF trimer (Supplementary Fig. S2 and Fig. 1[link]e). The hexamer is more stable than the trimer based on its calculated ΔGdiss value of 72.5 kcal mol−1 compared with 11.5 kcal mol−1 (Supplementary Fig. S2) for the trimer. Further analysis of untagged OvMIF-1 is required to determine the biological unit.

[Figure 1]
Figure 1
His-OvMIF-1 structure. (a) His-OvMIF-1 trimer with monomers colored cyan, wheat and gray. (b) The His-OvMIF-1 trimer (gray) has a jellyfish-like structure and the head aligns with the prototypical hMIF (blue). (c) Cartoon diagram of the longest His-OvMIF-1 monomer colored in a rainbow from blue at the N-terminus to red at the C-terminus. (d) Ribbon diagram of the longest His-OvMIF-1 monomer colored in a rainbow from blue at the N-terminus to red at the C-terminus. (e) PISA-generated His-OvMIF-1 tetramer.

Two chains have 111 ordered amino acids and the third has 105 of the 115 main-chain amino acids of His-OvMIF-1. Loop Cys67–Asn71 is disordered in all three monomers, and the N-terminal hexahistidine tag is disordered in all monomers. The three monomers are similar (Fig. 2[link]a), with an r.m.s.d. of 0.36 Å for the main-chain carbons (100 residues aligned). A closer comparison of the His-OvMIF-1 structures with hMIF-1 reveals that the additional N-terminal amino acids of His-OvMIF-1 block the space occupied by the carboxyl-terminus of hMIF-1 (Fig. 2[link]b) and prevent its ability to fold back, and may account for the formation of the unique `tail' instead. PDBeFold (https://www.ebi.ac.uk/msd-srv/ssm/; Krissinel & Henrick, 2004[Krissinel, E. & Henrick, K. (2004). Acta Cryst. D60, 2256-2268.]) analysis using the default threshold of 70% was used to identify the nearest structural neighbors of His-OvMIF-1 (Supplementary Table S2). Interestingly, the closest structural neighbors were hMIF structures, which was validated by ENDScript (Gouet et al., 2003[Gouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320-3323.]; Robert & Gouet, 2014[Robert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320-W324.]) analysis (Supplementary Fig. S3). His-OvMIF-1 has a prototypical MIF topology, except for the C-terminal extension and regions near the N-terminus, which are thicker in the ENDScript sausage plot (Supplementary Fig. S3). There is no correlation between tertiary-structure conservation and sequence identity between His-OvMIF-1 and its structural neighbors (Supplementary Figs. S3, S4 and S5).

[Figure 2]
Figure 2
Comparison of the His-OvMIF-1 and hMIF structures. (a) The superposed His-OvMIF-1 monomers (colored cyan, wheat and gray) are very similar. hMIF (colored magenta) lacks the tail. (b) The surface of His-OvMIF-1 (wheat) shows how its N-terminus occupies the location of the C-terminal residues of hMIF.

One of the most-studied parasite MIF homologs is that from the minor human hookworm (Ancylostoma ceylanicum) targeted for drug development by Lolis and coworkers (Cho et al., 2007[Cho, Y., Jones, B. F., Vermeire, J. J., Leng, L., DiFedele, L., Harrison, L. M., Xiong, H., Kwong, Y. K., Chen, Y., Bucala, R., Lolis, E. & Cappello, M. (2007). J. Biol. Chem. 282, 23447-23456.], 2011[Cho, Y., Vermeire, J. J., Merkel, J. S., Leng, L., Du, X., Bucala, R., Cappello, M. & Lolis, E. (2011). Chem. Biol. 18, 1089-1101.]). Like hMIF-1, the MIF homolog from A. ceylanicum (AceMIF) binds the CD74 receptor, inhibits macrophage migration and has tautomerase activity; however, significant structural differences were observed in the tautomerase sites (Cho et al., 2007[Cho, Y., Jones, B. F., Vermeire, J. J., Leng, L., DiFedele, L., Harrison, L. M., Xiong, H., Kwong, Y. K., Chen, Y., Bucala, R., Lolis, E. & Cappello, M. (2007). J. Biol. Chem. 282, 23447-23456.]). Interestingly, an hMIF-1 inhibitor, (S,R)-3-(4-hydroxyphenyl)-4,5-dihydro-5-isoxazole acetic acid, methyl ester (ISO-1), does not inhibit the tautomerase or chemoattractant activities of AceMIF, and this difference in inhibition is likely to be due to structural differences in the enzymatic sites which allow the binding of ISO-1 by hMIF-1 but not by AceMIF (Cho et al., 2007[Cho, Y., Jones, B. F., Vermeire, J. J., Leng, L., DiFedele, L., Harrison, L. M., Xiong, H., Kwong, Y. K., Chen, Y., Bucala, R., Lolis, E. & Cappello, M. (2007). J. Biol. Chem. 282, 23447-23456.]). To identify structural differences that may be important for AceMIF inhibition, we compared the active site of hMIF-1–ISO-1 with that of AceMIF complexed with furosemide. This AceMIF inhibitor was identified from drug-repositioning studies and from the Lolis group's high-throughput screening of over 1000 FDA-approved drugs (Cho et al., 2011[Cho, Y., Vermeire, J. J., Merkel, J. S., Leng, L., Du, X., Bucala, R., Cappello, M. & Lolis, E. (2011). Chem. Biol. 18, 1089-1101.]). The structure of AceMIF (PDB entry 3rf4, with furosemide) has an r.m.s.d. of 0.98 Å to Ov-MIF-1 on the alignment of 91 amino-acid residues, which is comparable to the r.m.s.d. of 1.12 Å for the alignment of hMIF-1 monomers (PDB entry 1mif). The tautomerase sites of hMIF-1–ISO-1 and AceMIF–furosemide reveal a network of residues interacting with each ligand (Supplementary Fig. S5). These amino acids are all near the interaction between the N-terminus and the C-terminal loop that is abrogated by the presence of the N-terminal purification tag in our His-OvMIF-1 structure. Thus, unlike the AceMIF and hMIF-1 structures, the cavity of His-OvMIF-1 for tautomerase inhibitors is blocked (Fig. 3[link]).

[Figure 3]
Figure 3
Comparison of tautomerase inhibitor-binding cavities in surface plots of hMIF-1 (cyan; PDB entry 1mif), AceMIF (purple; PDB entry 3rf4) and His-OvMIF-1 (gray). Furosemide (shown as sticks), a selective inhibitor of AceMIF, fits best into its larger cavity of AceMIF, hMIF has a smaller cavity and His-OvMIF-1 lacks the cavity (top row). The superposed trimer surfaces are shown in the bottom row. The structure of His-OvMIF-1 with the N-terminal tag in magenta is shown, as is the structure of OvMIF-1 generated by deleting the tag. OvMIF-1 has a more open cavity than the other structures.

The amino-terminal proline of MIF acts as a catalytic base for phenylpyruvate tautomerase activity (Lubetsky et al., 1999[Lubetsky, J. B., Swope, M., Dealwis, C., Blake, P. & Lolis, E. (1999). Biochemistry, 38, 7346-7354.]), which requires interactions with the carboxyl-terminal residues (Stamps et al., 1998[Stamps, S. L., Fitzgerald, M. C. & Whitman, C. P. (1998). Biochemistry, 37, 10195-10202.]). While the proline is conserved in OvMIF-1, its function is physically obscured in His-OvMIF-1 by the additional N-terminal residues. Deleting the residues corresponding to the N-terminal extension in our structure exposes the cavity (Fig. 3[link]), and OvMIF-1 appears to possess all of the features necessary for tautomerase activity. Interestingly, the in silico-generated OvMIF-1 cavity appears larger than that observed in hMIFs and easily accommodates furosemide, the selective AceMIF inhibitor. Based on this observation and the sequence and structure conservation (Fig. 4[link]), AceMIF inhibitors may be suitable starting points for the design of OvMIF-1 inhibitors. Other studies have shown that C-terminal histidine tags do not interfere with tautomerase, binding and other activities of plant MIFs (Sinitski et al., 2020[Sinitski, D., Gruner, K., Brandhofer, M., Kontos, C., Winkler, P., Reinstädler, A., Bourilhon, P., Xiao, Z., Cool, R., Kapurniotu, A., Dekker, F. J., Panstruga, R. & Bernhagen, J. (2020). J. Biol. Chem. 295, 850-867.]). Since the C-terminal residues of OvMIF-1 do not block the tautomerase site, using a C-terminal tag for purification rather than an N-terminal tag to preserve the tautomerase activity of OvMIF-1 is preferable.

[Figure 4]
Figure 4
Structural and primary-sequence alignment of His-OvMIF-1, hMIF-1, hMIF-2 and AceMIF. The secondary-structure elements are as follows: α-helices are shown as large coils, 310-helices are shown as small coils labeled h, β-strands are shown as arrows labeled β and β-turns are labeled TT. Identical residues are shown on a red background, with conserved residues in red and conserved regions in blue boxes. This figure was generated using ESPript 3.0 (Gouet et al., 1999[Gouet, P., Courcelle, E., Stuart, D. I. & Métoz, F. (1999). Bioinformatics, 15, 305-308.], 2003[Gouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320-3323.]). Additional structural details and alignments are shown in Supplementary Fig. S2.

Another binding partner of hMIF is the CD74 receptor (Leng et al., 2003[Leng, L., Metz, C. N., Fang, Y., Xu, J., Donnelly, S., Baugh, J., Delohery, T., Chen, Y., Mitchell, R. A. & Bucala, R. (2003). J. Exp. Med. 197, 1467-1476.]). hMIF–CD74 binding is unrelated to tautomerase binding, requires the formation of a trimer and is predicted to include the residues 50-FGGSEP-55, Lys76, 90-SPDR-93 and 109-NNS-111 from one monomer and residues 34-PQ-35, 108-WNN-110 and 111-STFA-114 from a second monomer (Meza-Romero et al., 2016[Meza-Romero, R., Benedek, G., Leng, L., Bucala, R. & Vandenbark, A. A. (2016). Metab. Brain Dis. 31, 249-255.]). These residues are partially conserved in OvMIF-1 at the levels of conservation of AceMIF (Fig. 4[link]). AceMIF is known to bind the CD74 receptor (Cho et al., 2007[Cho, Y., Jones, B. F., Vermeire, J. J., Leng, L., DiFedele, L., Harrison, L. M., Xiong, H., Kwong, Y. K., Chen, Y., Bucala, R., Lolis, E. & Cappello, M. (2007). J. Biol. Chem. 282, 23447-23456.]). Further studies are required to determine whether OvMIF-1 can interact with CD74. Additional studies are required to determine whether previously identified hMIF-1 allosteric inhibitors (Bai et al., 2012[Bai, F., Asojo, O. A., Cirillo, P., Ciustea, M., Ledizet, M., Aristoff, P. A., Leng, L., Koski, R. A., Powell, T. J., Bucala, R. & Anthony, K. G. (2012). J. Biol. Chem. 287, 30653-30663.]; Cirillo et al., 2020[Cirillo, P. F., Asojo, O. A., Khire, U., Lee, Y., Mootien, S., Hegan, P., Sutherland, A. G., Peterson-Roth, E., Ledizet, M., Koski, R. A. & Anthony, K. G. (2020). ACS Med. Chem. Lett. 11, 1843-1847.]) will bind to OvMIF-1.

4. Conclusion

We report the production, crystallization and 1.9 Å resolution structure of N-terminally hexahistidine-tagged O. volvulus macrophage migration inhibitory factor-1 (His-OvMIF-1). The carboxyl-terminal residues of His-OvMIF-1 form a long tail instead of folding back to interact with the N-terminus to form the tautomerase cavity. In silico removal of the N-terminal tag exposes a large cavity that can be used for drug discovery. Future studies will include testing the activity, removing the N-terminal tag and generating co-crystal structures of OvMIF-1 with known MIF inhibitors.

Acknowledgements

This project is part of an SSGCID outreach led by OAA to train diverse students and faculty in structural science and scientific communication. ADK is a Clinical Diagnostic Microbiology Instructor at Howard University in Washington DC and OCOD is a senior at Grafton High in Yorktown, Virginia.

Biographical information

[link]

[Scheme 1]
Early career authors: Amber D. Kimble and Omolara C. O. Dawson.

Funding information

This project has been funded in whole or in part with Federal funds from the National Institute of Allergy and Infectious Diseases, National Institutes of Health, Department of Health and Human Services, under Contract No. 75N93022C00036. This research used resources of the NYX beamline 19-ID, supported by the New York Structural Biology Center, at the National Synchrotron Light Source II, a US Department of Energy (DOE) Office of Science User Facility operated for the DOE Office of Science by Brookhaven National Laboratory under Contract No. DE-SC0012704. The NYX detector instrumentation was supported by grant S10OD030394 through the Office of the Director of the National Institutes of Health.

References

First citationAgirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449–461.  Web of Science CrossRef IUCr Journals Google Scholar
First citationBai, F., Asojo, O. A., Cirillo, P., Ciustea, M., Ledizet, M., Aristoff, P. A., Leng, L., Koski, R. A., Powell, T. J., Bucala, R. & Anthony, K. G. (2012). J. Biol. Chem. 287, 30653–30663.  Web of Science CrossRef CAS PubMed Google Scholar
First citationBenedek, G., Abed El Latif, M., Miller, K., Rivkin, M., Ramadhan Lasu, A. A., Riek, L. P., Lako, R., Edvardson, S., Alon, S. A., Galun, E. & Levite, M. (2020). PLoS Negl. Trop. Dis. 14, e0008436.  Web of Science CrossRef PubMed Google Scholar
First citationBernhagen, J., Krohn, R., Lue, H., Gregory, J. L., Zernecke, A., Koenen, R. R., Dewor, M., Georgiev, I., Schober, A., Leng, L., Kooistra, T., Fingerle-Rowson, G., Ghezzi, P., Kleemann, R., McColl, S. R., Bucala, R., Hickey, M. J. & Weber, C. (2007). Nat. Med. 13, 587–596.  Web of Science CrossRef PubMed CAS Google Scholar
First citationBoullé, C., Chesnais, C. B., Kamgno, J., Gardon, J., Chippaux, J., Ranque, S., Garcia, A., Pion, S. D. & Boussinesq, M. (2023). Lancet Microbe, 4, e93–e101.  Web of Science PubMed Google Scholar
First citationBuchko, G. W., Abendroth, J., Robinson, H., Zhang, Y., Hewitt, S. N., Edwards, T. E., Van Voorhis, W. C. & Myler, P. J. (2013). J. Struct. Funct. Genomics, 14, 47–57.  CrossRef CAS PubMed Google Scholar
First citationChesnais, C. B., Nana-Djeunga, H. C., Njamnshi, A. K., Lenou-Nanga, C. G., Boullé, C., Bissek, A. Z., Kamgno, J., Colebunders, R. & Boussinesq, M. (2018). Lancet Infect. Dis. 18, 1278–1286.  Web of Science CrossRef PubMed Google Scholar
First citationCho, Y., Jones, B. F., Vermeire, J. J., Leng, L., DiFedele, L., Harrison, L. M., Xiong, H., Kwong, Y. K., Chen, Y., Bucala, R., Lolis, E. & Cappello, M. (2007). J. Biol. Chem. 282, 23447–23456.  Web of Science CrossRef PubMed CAS Google Scholar
First citationCho, Y., Vermeire, J. J., Merkel, J. S., Leng, L., Du, X., Bucala, R., Cappello, M. & Lolis, E. (2011). Chem. Biol. 18, 1089–1101.  Web of Science CrossRef CAS PubMed Google Scholar
First citationCirillo, P. F., Asojo, O. A., Khire, U., Lee, Y., Mootien, S., Hegan, P., Sutherland, A. G., Peterson-Roth, E., Ledizet, M., Koski, R. A. & Anthony, K. G. (2020). ACS Med. Chem. Lett. 11, 1843–1847.  Web of Science CrossRef CAS PubMed Google Scholar
First citationColebunders, R., Hadermann, A. & Siewe Fodjo, J. N. (2023). PLoS Negl. Trop. Dis. 17, e0011523.  Web of Science CrossRef PubMed Google Scholar
First citationColebunders, R., Siewe Fodjo, J. N., Kamoen, O., Amaral, L.-J., Hadermann, A., Trevisan, C., Taylor, M. J., Gauglitz, J., Hoerauf, A., Sato, Y., Polman, K., Basanez, M.-G., Bhwana, D., Lakwo, T., Abd-Elfarag, G. & Pion, S. D. (2024). Infect. Dis. Poverty, 13, 5.  Web of Science CrossRef PubMed Google Scholar
First citationCollaborative Computational Project, Number 4 (1994). Acta Cryst. D50, 760–763.  CrossRef Web of Science IUCr Journals Google Scholar
First citationCupp, E. W., Mackenzie, C. D. & Unnasch, T. R. (2011). Res. Rep. Trop. Med. 2, 81–92.  PubMed Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationErber, A. C., Ariyo, E., Olliaro, P., Nicolas, P., Chaccour, C. & Colebunders, R. (2021). Pathogens, 10, 1588.  Web of Science CrossRef PubMed Google Scholar
First citationEvans, P. (2006). Acta Cryst. D62, 72–82.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationFalcone, F. H., Loke, P., Zang, X., MacDonald, A. S., Maizels, R. M. & Allen, J. E. (2001). J. Immunol. 167, 5348–5354.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGouet, P., Courcelle, E., Stuart, D. I. & Métoz, F. (1999). Bioinformatics, 15, 305–308.  Web of Science CrossRef PubMed CAS Google Scholar
First citationGouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320–3323.  Web of Science CrossRef PubMed CAS Google Scholar
First citationHigazi, T. B., Geary, T. G. & Mackenzie, C. D. (2014). Res. Rep. Trop. Med. 5, 77–93.  PubMed Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKlasen, C., Ohl, K., Sternkopf, M., Shachar, I., Schmitz, C., Heussen, N., Hobeika, E., Levit-Zerdoun, E., Tenbrock, K., Reth, M., Bernhagen, J. & El Bounkari, O. (2014). J. Immunol. 192, 5273–5284.  Web of Science CrossRef CAS PubMed Google Scholar
First citationKowiel, M., Brzezinski, D., Porebski, P. J., Shabalin, I. G., Jaskolski, M. & Minor, W. (2019). Bioinformatics, 35, 452–461.  Web of Science CrossRef CAS PubMed Google Scholar
First citationKrissinel, E. (2010). J. Comput. Chem. 31, 133–143.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKrissinel, E. & Henrick, K. (2004). Acta Cryst. D60, 2256–2268.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKrissinel, E. & Henrick, K. (2005). CompLife 2005, edited by M. R. Berthold, R. C. Glen, K. Diederichs, O. Kohlbacher & I. Fischer, pp. 163–174. Berlin, Heidelberg: Springer-Verlag.  Google Scholar
First citationKrissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774–797.  Web of Science CrossRef PubMed CAS Google Scholar
First citationKrissinel, E. B., Winn, M. D., Ballard, C. C., Ashton, A. W., Patel, P., Potterton, E. A., McNicholas, S. J., Cowtan, K. D. & Emsley, P. (2004). Acta Cryst. D60, 2250–2255.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationLeng, L., Metz, C. N., Fang, Y., Xu, J., Donnelly, S., Baugh, J., Delohery, T., Chen, Y., Mitchell, R. A. & Bucala, R. (2003). J. Exp. Med. 197, 1467–1476.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
First citationLoukas, A., Constant, S. L. & Bethony, J. M. (2005). FEMS Immunol. Med. Microbiol. 43, 115–124.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLoukas, A. & Prociv, P. (2001). Clin. Microbiol. Rev. 14, 689–703.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLubetsky, J. B., Swope, M., Dealwis, C., Blake, P. & Lolis, E. (1999). Biochemistry, 38, 7346–7354.  Web of Science CrossRef PubMed CAS Google Scholar
First citationLustigman, S. & McCarter, J. P. (2007). PLoS Negl. Trop. Dis. 1, e76.  Web of Science CrossRef PubMed Google Scholar
First citationMartin, R. J., Robertson, A. P. & Choudhary, S. (2021). Trends Parasitol. 37, 48–64.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMeza-Romero, R., Benedek, G., Leng, L., Bucala, R. & Vandenbark, A. A. (2016). Metab. Brain Dis. 31, 249–255.  Web of Science CAS PubMed Google Scholar
First citationNicolas, P., Maia, M. F., Bassat, Q., Kobylinski, K. C., Monteiro, W., Rabinovich, N. R., Menendez, C., Bardaji, A. & Chaccour, C. (2020). Lancet Glob. Health, 8, e92–e100.  CrossRef PubMed Google Scholar
First citationNikièma, A. S., Koala, L., Post, R. J., Paré, A. B., Kafando, C. M., Drabo, F., Belem, A. M. G., Dabiré, R. K. & Traoré, S. (2018). Acta Trop. 185, 176–182.  Web of Science PubMed Google Scholar
First citationOlum, S., Scolding, P., Hardy, C., Obol, J. & Scolding, N. J. (2020). Brain Commun. 2, fcaa037.  Web of Science CrossRef PubMed Google Scholar
First citationOsei-Atweneboana, M. Y., Awadzi, K., Attah, S. K., Boakye, D. A., Gyapong, J. O. & Prichard, R. K. (2011). PLoS Negl. Trop. Dis. 5, e998.  Web of Science PubMed Google Scholar
First citationPastrana, D. V., Raghavan, N., FitzGerald, P., Eisinger, S. W., Metz, C., Bucala, R., Schleimer, R. P., Bickel, C. & Scott, A. L. (1998). Infect. Immun. 66, 5955–5963.  Web of Science CrossRef CAS PubMed Google Scholar
First citationRobert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320–W324.  Web of Science CrossRef CAS PubMed Google Scholar
First citationRodríguez-Hernández, D., Vijayan, K., Zigweid, R., Fenwick, M. K., Sankaran, B., Roobsoong, W., Sattabongkot, J., Glennon, E. K. K., Myler, P. J., Sunnerhagen, P., Staker, B. L., Kaushansky, A. & Grøtli, M. (2023). Nat. Commun. 14, 5408.  Web of Science PubMed Google Scholar
First citationRodríguez-Sosa, M., Rosas, L. E., David, J. R., Bojalil, R., Satoskar, A. R. & Terrazas, L. I. (2003). Infect. Immun. 71, 1247–1254.  Web of Science PubMed Google Scholar
First citationSerbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594–599.  Web of Science CrossRef IUCr Journals Google Scholar
First citationSinitski, D., Gruner, K., Brandhofer, M., Kontos, C., Winkler, P., Reinstädler, A., Bourilhon, P., Xiao, Z., Cool, R., Kapurniotu, A., Dekker, F. J., Panstruga, R. & Bernhagen, J. (2020). J. Biol. Chem. 295, 850–867.  CrossRef PubMed Google Scholar
First citationStacy, R., Begley, D. W., Phan, I., Staker, B. L., Van Voorhis, W. C., Varani, G., Buchko, G. W., Stewart, L. J. & Myler, P. J. (2011). Acta Cryst. F67, 979–984.  Web of Science CrossRef IUCr Journals Google Scholar
First citationStamps, S. L., Fitzgerald, M. C. & Whitman, C. P. (1998). Biochemistry, 37, 10195–10202.  Web of Science CrossRef CAS PubMed Google Scholar
First citationStapley, J. N., Hamley, J. I. D., Walker, M., Dixon, M. A., Colebunders, R. & Basáñez, M. G. (2024). Nat. Commun. 15, 6275.  Web of Science CrossRef PubMed Google Scholar
First citationStudier, F. W. (2005). Protein Expr. Purif. 41, 207–234.  Web of Science CrossRef PubMed CAS Google Scholar
First citationSun, H. W., Bernhagen, J., Bucala, R. & Lolis, E. (1996). Proc. Natl Acad. Sci. USA, 93, 5191–5196.  CrossRef CAS PubMed Web of Science Google Scholar
First citationTekle, A. H., Elhassan, E., Isiyaku, S., Amazigo, U. V., Bush, S., Noma, M., Cousens, S., Abiose, A. & Remme, J. H. (2012). Parasit. Vectors, 5, 28  Web of Science CrossRef PubMed Google Scholar
First citationTirados, I., Thomsen, E., Worrall, E., Koala, L., Melachio, T. T. & Basáñez, M. G. (2022). Trends Parasitol. 38, 591–604.  Web of Science CrossRef PubMed Google Scholar
First citationVan Cutsem, G., Siewe Fodjo, J. N., Hadermann, A., Amaral, L. J., Trevisan, C., Pion, S. & Colebunders, R. (2024). Seizure, https://doi.org/10.1016/j.seizure.2024.04.018.  Google Scholar
First citationVermeire, J. J., Cho, Y., Lolis, E., Bucala, R. & Cappello, M. (2008). Trends Parasitol. 24, 355–363.  Web of Science CrossRef PubMed CAS Google Scholar
First citationWilliams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, J. S. (2018). Protein Sci. 27, 293–315.  Web of Science CrossRef CAS PubMed Google Scholar
First citationWinn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds