research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Structural and biochemical characterization of the M405S variant of Desulfovibrio vulgaris formate de­hydrogenase

crossmark logo

aUCIBIO, Applied Molecular Biosciences Unit, Department of Chemistry, NOVA School of Science and Technology, Universidade NOVA de Lisboa, 2829-516 Caparica, Portugal, bAssociate Laboratory i4HB – Institute for Health and Bioeconomy, NOVA School of Science and Technology, Universidade NOVA de Lisboa, 2829-516 Caparica, Portugal, and cInstituto de Tecnologia Química e Biológica António Xavier, Universidade NOVA de Lisboa, Avenida da República, 2780-157 Oeiras, Portugal
*Correspondence e-mail: [email protected]

Edited by N. Sträter, University of Leipzig, Germany (Received 26 February 2024; accepted 29 April 2024)

This article is part of a collection of articles from the IUCr 2023 Congress in Melbourne, Australia, and commemorates the 75th anniversary of the IUCr.

Molybdenum- or tungsten-dependent formate dehydrogenases have emerged as significant catalysts for the chemical reduction of CO2 to formate, with biotechnological applications envisaged in climate-change mitigation. The role of Met405 in the active site of Desulfovibrio vulgaris formate dehydrogenase AB (DvFdhAB) has remained elusive. However, its proximity to the metal site and the conformational change that it undergoes between the resting and active forms suggests a functional role. In this work, the M405S variant was engineered, which allowed the active-site geometry in the absence of methionine Sδ interactions with the metal site to be revealed and the role of Met405 in catalysis to be probed. This variant displayed reduced activity in both formate oxidation and CO2 reduction, together with an increased sensitivity to oxygen inactivation.

1. Introduction

The conversion of CO2 to value-added products is in high demand as climate-change mitigation measures become increasingly relevant. Nonetheless, these are chemically challenging reactions as CO2 is inherently thermodynamically stable, posing extensive challenges to an energy-efficient industrial implementation (Appel et al., 2013[Appel, A. M., Bercaw, J. E., Bocarsly, A. B., Dobbek, H., DuBois, D. L., Dupuis, M., Ferry, J. G., Fujita, E., Hille, R., Kenis, P. J. A., Kerfeld, C. A., Morris, R. H., Peden, C. H. F., Portis, A. R., Ragsdale, S. W., Rauchfuss, T. B., Reek, J. N. H., Seefeldt, L. C., Thauer, R. K. & Waldrop, G. L. (2013). Chem. Rev. 113, 6621-6658.]; Calzadiaz-Ramirez & Meyer, 2022[Calzadiaz-Ramirez, L. & Meyer, A. S. (2022). Curr. Opin. Biotechnol. 73, 95-100.]; Aresta et al., 2013[Aresta, M., Dibenedetto, A. & Angelini, A. (2013). J. CO2 Util. 3-4, 65-73.]). Metal-dependent formate dehydrogenases (Fdhs) have been tailored by evolution to accomplish this reaction efficiently, selectively and with high activity, leading to an increasing interest in the development of optimized versions of these enzymes as well as of bio-inspired inorganic catalysts (Szczesny et al., 2020[Szczesny, J., Ruff, A., Oliveira, A. R., Pita, M., Pereira, I. A. C., De Lacey, A. L. & Schuhmann, W. (2020). ACS Energy Lett. 5, 321-327.]; Lodh & Roy, 2022[Lodh, J. & Roy, S. (2022). J. Inorg. Biochem. 234, 111903.]; Kanega et al., 2020[Kanega, R., Ertem, M. Z., Onishi, N., Szalda, D. J., Fujita, E. & Himeda, Y. (2020). Organometallics, 39, 1519-1531.]).

Molybdenum/tungsten-dependent Fdhs present diverse quaternary structures, allowing them to assume diverse metabolic roles (da Silva et al., 2013[Silva, S. M. da, Voordouw, J., Leitão, C., Martins, M., Voordouw, G. & Pereira, I. A. C. (2013). Microbiology, 159, 1760-1769. ]) while interacting with a large assortment of electron acceptors/mediators that are located in membranes or soluble in the cytoplasm and periplasm (Boyington et al., 1997[Boyington, J. C., Gladyshev, V. N., Khangulov, S. V., Stadtman, T. C. & Sun, P. D. (1997). Science, 275, 1305-1308.]; Jormakka et al., 2002[Jormakka, M., Törnroth, S., Byrne, B. & Iwata, S. (2002). Science, 295, 1863-1868.]; Radon et al., 2020[Radon, C., Mittelstädt, G., Duffus, B. R., Bürger, J., Hartmann, T., Mielke, T., Teutloff, C., Leimkühler, S. & Wendler, P. (2020). Nat. Commun. 11, 1912.]; Young et al., 2020[Young, T., Niks, D., Hakopian, S., Tam, T. K., Yu, X., Hille, R. & Blaha, G. M. (2020). J. Biol. Chem. 295, 6570-6585.]; Oliveira et al., 2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]; Raaijmakers et al., 2002[Raaijmakers, H., Macieira, S., Dias, J. M., Teixeira, S., Bursakov, S., Huber, R., Moura, J. J. G., Moura, I. & Romão, M. J. (2002). Structure, 10, 1261-1272.]). These enzymes accommodate a wide diversity of β and/or γ subunits harbouring iron–sulfur clusters, haem groups and flavins, but the catalytic subunit (α subunit) is ubiquitously conserved. This subunit contains the molybdenum/tungsten active site and one [4Fe–4S] cluster (for electron shuttling) and is responsible for the reversible conversion of formate to CO2 with a substantially higher turnover than its metal-independent counterparts (Maia et al., 2015[Maia, L. B., Moura, J. J. G. & Moura, I. (2015). J. Biol. Inorg. Chem. 20, 287-309.]; Nielsen et al., 2019[Nielsen, C. F., Lange, L. & Meyer, A. S. (2019). Biotechnol. Adv. 37, 107408.]).

In the active site, the Mo/W atom coordinates two dithiolenes from two molybdopterin guanine dinucleotides (MGDs), one terminal sulfido ligand (—SH/=S) and a (seleno)cysteine residue from the polypeptide chain in a distorted trigonal prismatic geometry (Romão, 2009[Romão, M. J. (2009). Dalton Trans., pp. 4053-4068.]; Hille et al., 2014[Hille, R., Hall, J. & Basu, P. (2014). Chem. Rev. 114, 3963-4038.]; Grimaldi et al., 2013[Grimaldi, S., Schoepp-Cothenet, B., Ceccaldi, P., Guigliarelli, B. & Magalon, A. (2013). Biochim. Biophys. Acta, 1827, 1048-1085.]). The two MGD ligands are structurally equivalent but have different roles. MGD1 (the proximal MGD) is involved in electron transfer from the molybdenum/tungsten centre to the first [4Fe–4S] cluster (Oliveira et al., 2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]; Raaijmakers et al., 2002[Raaijmakers, H., Macieira, S., Dias, J. M., Teixeira, S., Bursakov, S., Huber, R., Moura, J. J. G., Moura, I. & Romão, M. J. (2002). Structure, 10, 1261-1272.]; Supplementary Fig. S1). MGD2 (the distal MGD) is believed to play a role in modulation of the molybdenum/tungsten redox potential (Oliveira et al., 2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]). In the second coordination sphere of the metal, two conserved residues are catalytically relevant: a histidine thought to play a role in proton transfer (Oliveira et al., 2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]) and an arginine involved in substrate orientation and stabilization of putative catalytic intermediates (Oliveira et al., 2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]; Siegbahn, 2022[Siegbahn, P. E. M. (2022). J. Phys. Chem. B, 126, 1728-1733.]).

In the particular case of the tungsten FdhAB from Desulfovibrio vulgaris (DvFdhAB), a selenocysteine coordinates the tungsten ion and the enzyme displays a simple heterodimeric structure: a catalytic α subunit (harbouring the tungsten active site and one [4Fe–4S] centre) and a β subunit (with three [4Fe–4S] clusters) involved in electron transfer to/from electron acceptors/donors (Oliveira et al., 2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]).

In spite of several studies, doubts persist regarding the catalytic mechanism, particularly in relation to the dissociation of the (seleno)cysteine during catalysis (Raaijmakers & Romão, 2006[Raaijmakers, H. C. A. & Romão, M. J. (2006). J. Biol. Inorg. Chem. 11, 849-854.]; Schrapers et al., 2015[Schrapers, P., Hartmann, T., Kositzki, R., Dau, H., Reschke, S., Schulzke, C., Leimkühler, S. & Haumann, M. (2015). Inorg. Chem. 54, 3260-3271.]; Oliveira et al., 2022[Oliveira, A. R., Mota, C., Klymanska, K., Biaso, F., Romao, M. J., Guigliarelli, B. & Pereira, I. C. (2022). ACS Chem. Biol. 17, 1901-1909.]) and/or the transfer of a formal hydride (H+ + 2e−) between the metal site and the substrate (Schrapers et al., 2015[Schrapers, P., Hartmann, T., Kositzki, R., Dau, H., Reschke, S., Schulzke, C., Leimkühler, S. & Haumann, M. (2015). Inorg. Chem. 54, 3260-3271.]; Niks & Hille, 2019[Niks, D. & Hille, R. (2019). Protein Sci. 28, 111-122.]; Siegbahn, 2022[Siegbahn, P. E. M. (2022). J. Phys. Chem. B, 126, 1728-1733.]).

In a recent study of DvFdhAB, a disulfide redox switch was shown to be crucial in an allosteric mechanism for enzyme activation (yielding maximum activity) or inactivation (resulting in protection against O2 damage) (Oliveira et al., 2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.]). When the disulfide bond is reduced, the highest catalytic activity for CO2 reduction is achieved. On the other hand, in the presence of the disulfide bond the kcat decreases by 90% and the Km increases. The allosteric mechanism involves large conformational changes, namely of the side chain of Met405, a residue located near the active site that is fully conserved in the subclass of Fdhs that contain the recently reported allo­steric redox switch for protection against oxygen-induced damage. The M405A mutation virtually abolished the catalytic activity (Oliveira et al., 2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.]) and its structure revealed a significant distortion of the active site, particularly the protein backbone near SeCys192 (U192), preventing modelling of the side chain of U192. The mutation proved to be too severe, preventing clarification of the possible catalytic role of Met405 and suggesting a major structural role for this residue.

Here, we report the crystal structure of the M405S variant of DvFdhAB and its kinetic characterization. The hexacoordinated tungsten active site could now be fully modelled and allowed the prominent role of Met405 in the geometry of the metal site to be probed.

2. Materials and methods

2.1. Expression, purification and kinetic assays of D. vulgaris FdhAB

DvFdhAB M405S was expressed and affinity-purified from D. vulgaris Hildenborough as described in Oliveira et al. (2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]) (Table 1[link]). Affinity chromatography was performed aerobically and anaerobically using Strep-TactinXT 4Flow resin (IBA Lifesciences), eluting the protein with 100 mM Tris–HCl buffer containing 150 mM NaCl and 50 mM biotin. Anaerobic purification was performed inside a Coy anaerobic chamber (2% H2/98% N2) using the same method as aerobic purification. The protein concentration was determined based on ɛ410 nm = 43.45 mM−1 cm−1. After protein purification, kinetic assays were performed as reported in Oliveira et al. (2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]) with DTT pretreatment and a final DvFdhAB M405S concentration of 14 nM using a UV-1800 Shimadzu spectrophotometer inside a Coy anaerobic chamber (2% H2/98% N2).

Table 1
Macromolecule-production information

Source organism D. vulgaris Hildenborough
DNA source Mutated native DNA sequence
Expression vector pMO9075
Plasmid construction method Sequence- and ligation-independent cloning (SLIC) and site-directed mutagenesis
Forward primer (cloning)
 FdhA 5′-GCAGTCCCAGGAGGTACCATATGACAGTCACACGCAGACATTTCC-3′
 FdhB 5′-CGCCTTCTTGACGAGTTCTTCTGAGGAGGTAGGTCATGGGAAAGATGTTCTTC-3′
Reverse primer (cloning)
 FdhA 5′-GAAACGATCCTCATCCCTATTTTTCGAACTGCGGGTGGCTCCAGACCTTGCGGACGTCCACCATG-3′
 FdhB 5′-CTTCATGATCGGGTCTTTTCGTTCAGGCACGTGGCCGGAACAA-3′
Expression host D. vulgaris Hildenborough ΔfdhAB deletion strain
Complete amino-acid sequence of the protein produced
 FdhA MTVTRRHFLKLSAGAAVAGAFTGLGLSLAPTVARAELQKLQWAKQTTSICCYCAVGCGLIVHTAKDGQGRAVNVEGDPDHPINEGSLCPKGASIFQLGENDQRGTQPLYRAPFSDTWKPVTWDFALTEIAKRIKKTRDASFTEKNAAGDLVNRTEAIASFGSAAMDNEECWAYGNILRSLGLVYIEHQARIUHSPTVPALAESFGRGAMTNHWNDLANSDCILIMGSNAAENHPIAFKWVLRAKDKGATLIHVDPRFTRTSARCDVYAPIRSGADIPFLGGLIKYILDNKLYFTDYVREYTNASLIVGEKFSFKDGLFSGYDAANKKYDKSMWAFELDANGVPKRDPALKHPRCVINLLKKHYERYNLDKVAAITGTSKEQLQQVYKAYAATGKPDKAGTIMYASGWTQHSVGVQNIRAMAMIQLLLGNIGVAGGGVNALRGESNVQGSTDQGLLAHIWPGYNPVPNSKAATLELYNAATPQSKDPMSVNWWQNRPKYVASYLKALYPDEEPAAAYDYLPRIDAGRKLTDYFWLNIFEKMDKGEFKGLFAWGMNPACGGANANKNRKAMGKLEWLVNVNLFENETSSFWKGPGMNPAEIGTEVFFLPCCVSIEKEGSVANSGRWMQWRYRGPKPYAETKPDGDIMLDMFKKVRELYAKEGGAYPAPIAKLNIADWEEHNEFSPTKVAKLMNGYFLKDTEVGGKQFKKGQQVPSFAFLTADGSTCSGNWLHAGSFTDAGNLMARRDKTQTPEQARIGLFPNWSFCWPVNRRILYNRASVDKTGKPWNPAKAVIEWKDGKWVGDVVDGGGDPGTKHPFIMQTHGFGALYGPGREEGPFPEHYEPLECPVSKNPFSKQLHNPVAFQIEGEKKAVCDPRYPFIGTTYRVTEHWQTGLMTRRCAWLVEAEPQIFCEISKELAKLRGIGNGDTVKVSSLRGALEAVAIVTERIRPFKIEGVDVHMVGLPWHYGWMVPKNGGDTANLLTPSAGDPNTGIPETKAFMVDVRKVWSHPQFEK
 FdhB MGKMFFVDLSRCTACRGCQIACKQWKNLPAEETRNTGSHQNPPDLSYVTLKTVRFTEKSRKGPGIDWLFFPEQCRHCVEPPCKGQADVDLEGAVVKDETTGAVLFTELTAKVDGESVRSACPYDIPRIDPVTKRLSKCDMCNDRVQNGLLPACVKTCPTGTMNFGDEQEMLALAEKRLAEVKKTYPGAVLGDPNDVRVVYLFTRDPKDFYEHAVA

2.2. Crystallization, data collection, structure solution and refinement

To obtain the crystallization conditions for the M405S variant, we started from the wild-type (WT) crystallization conditions reported in Oliveira et al. (2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]) and performed microseeding. The conditions were optimized by varying the PEG 3350 concentration and by microseed dilution.

DvFdhAB M405S [15 mg ml−1 in 20 mM Tris–HCl pH 7.6, 10%(v/v) glycerol, 10 mM NaNO3 buffer] was crystallized at 20°C using the hanging-drop vapour-diffusion method in 24-well plates (24-well XRL plates from Molecular Dimensions) with drops containing precipitant solution consisting of 32%(w/v) PEG 3350, 0.1 M Tris–HCl pH 8.0, 1 M LiCl (Oliveira et al., 2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.]) and a 1:500 dilution from a stock of microseeds of DvFdhAB WT with a 1:1:0.2 ratio of protein:precipitant:microseeds (Table 2[link]).

Table 2
Summary of crystallization conditions

Method Vapour diffusion, hanging drop
Plate type 24-well XRL plate (Molecular Dimensions)
Temperature (°C) 20
Protein concentration (mg ml−1) 15
Composition of the protein solution 20 mM Tris–HCl pH 7.6, 10%(v/v) glycerol, 10 mM NaNO3
Composition of the reservoir solution 32%(w/v) PEG 3350, 0.1 M Tris–HCl pH 8.0, 1 M LiCl
Volume and ratio of drop 2.2 µl of a 1:1:0.2 µl ratio of protein:precipitant:microseed dilution
Volume of reservoir (µl) 500
Composition of the cryoprotectant 20%(v/v) glycerol, 32%(w/v) PEG 3350, 0.1 M Tris–HCl pH 8.0, 1 M LiCl
Drop setting Manual
Seeding Yes, 1:500 dilution of stock WT FdhAB seeds

Crystals appeared within 24 h, grew for 72 h and were flash-cooled in liquid nitrogen using the harvesting buffer supplemented with 20%(v/v) glycerol as a cryoprotectant.

X-ray diffraction experiments were performed on beamline ID30B (McCarthy et al., 2018[McCarthy, A. A., Barrett, R., Beteva, A., Caserotto, H., Dobias, F., Felisaz, F., Giraud, T., Guijarro, M., Janocha, R., Khadrouche, A., Lentini, M., Leonard, G. A., Lopez Marrero, M., Malbet-Monaco, S., McSweeney, S., Nurizzo, D., Papp, G., Rossi, C., Sinoir, J., Sorez, C., Surr, J., Svensson, O., Zander, U., Cipriani, F., Theveneau, P. & Mueller-Dieckmann, C. (2018). J. Synchrotron Rad. 25, 1249-1260.]) at the ESRF synchrotron, Grenoble, France. The crystals were cryocooled at 100 K and data processing was performed using XDS (Kabsch, 2010[Kabsch, W. (2010). Acta Cryst. D66, 125-132.]) and STARANISO (Vonrhein et al., 2018[Vonrhein, C., Tickle, I. J., Flensburg, C., Keller, P., Paciorek, W., Sharff, A. & Bricogne, G. (2018). Acta Cryst. A74, a360.]). As the data showed anisotropy, STARANISO was used to improve the overall quality of the final electron-density maps. Molecular replacement with Phaser (McCoy et al., 2007[McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658-674.]) from the CCP4 suite (Agirre et al., 2023[Agirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449-461.]) was used to solve the structure using the oxidized WT DvFdhAB structure (PDB entry 6sdr) as a search model. The model was iteratively refined by cycles of automatic restrained refinement with REFMAC5 (Murshudov et al., 2011[Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355-367.]) and manual model building with Coot (Emsley et al., 2010[Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486-501.]). The model was rebuilt using the online PDB-REDO server (Joosten et al., 2009[Joosten, R. P., Salzemann, J., Bloch, V., Stockinger, H., Berglund, A.-C., Blanchet, C., Bongcam-Rudloff, E., Combet, C., Da Costa, A. L., Deleage, G., Diarena, M., Fabbretti, R., Fettahi, G., Flegel, V., Gisel, A., Kasam, V., Kervinen, T., Korpelainen, E., Mattila, K., Pagni, M., Reichstadt, M., Breton, V., Tickle, I. J. & Vriend, G. (2009). J. Appl. Cryst. 42, 376-384.]) and publication images were generated with PyMOL (Schrödinger). Data-collection and processing statistics and model-refinement statistics are presented in Tables 3[link] and 4[link], respectively.

Table 3
Data-collection and processing statistics

Values in parentheses are for the outer shell.

  DvFdhAB M405S DvFdhAB M405S (STARANISO)
PDB code   8rcg
Diffraction source ID30B, ESRF ID30B, ESRF
Wavelength (Å) 0.8731 0.8731
Temperature (K) 100 100
Crystal-to-detector distance (mm) 231.55 231.55
Rotation range per image (°) 0.05 0.05
Total rotation range (°) 360 360
Space group P212121 P212121
a, b, c (Å) 64.34, 127.23, 148.27 64.34, 127.23, 148.27
Mosaicity (°) 0.03 0.03
Resolution range (Å) 48.59–2.00 (2.11–2.00) 48.59–2.00 (2.12–2.00)
Total No. of reflections 377283 (60741) 329055 (19634)
No. of unique reflections 83264 (13159) 71441 (3573)
Completeness (%) 99.00 (98.30) 93.02 (49.47)
Multiplicity 4.5 (4.6) 4.6 (5.5)
〈I/σ(I)〉 7.1 (1.0) 7.4 (1.5)
Rmeas 0.150 (1.572) 0.144 (1.305)
CC1/2 0.996 (0.375) 0.996 (0.562)

Table 4
Refinement statistics

Values in parentheses are for the outer shell.

  DvFdhAB M405S (STARANISO)
PDB code 8rcg
Resolution range (Å) 48.59–2.00 (2.06–2.00)
Final Rcryst 0.212 (0.333)
Final Rfree 0.253 (0.402)
No. of non-H atoms
 Total 9610
 Protein 9197
 Ligand 167
 Ion 2
 Water 244
R.m.s. deviations
 Bond lengths (Å) 0.005
 Angles (°) 1.313
Average B factors (Å2)
 Overall 40.17
 Protein 43.00
 Ligand 36.77
 Ion 47.67
 Water 34.58
Ramachandran plot
 Most favoured (%) 96.15
 Outliers (%) 0.17
MolProbity score 1.60
Clashscore 5.42

3. Results and discussion

3.1. Biochemical characterization of DvFdhAB M405S

The DvFdhAB M405S variant presents an eightfold lower activity for formate oxidation and an 18-fold lower activity for CO2 reduction compared with the WT enzyme (Table 5[link]). A strong loss of activity was previously reported for the M405A variant, where the activities were 16-fold and eightfold lower than those of WT DvFdhAB for formate oxidation and CO2 reduction, respectively (Table 5[link]; Oliveira et al., 2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.]). The Km of the M405S variant for formate was twice that of the WT and the M405A variant (Table 5[link]). On the other hand, the Km for CO2 was equally high for both variants and was two orders of magnitude higher than that of the WT (Oliveira et al., 2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.]). Although the difference in the kinetic parameters of both variants relative to the WT was not the same, the efficiencies (kcat/Km) for formate oxidation and CO2 reduction were similar (Table 5[link]). The activities of both variants increased slightly when the proteins were purified anaerobically (Figs. 1[link]a and 1[link]b). This reveals that the variants are more sensitive to oxygen than WT DvFdhAB, for which the activity after anaerobic purification did not increase (Oliveira et al., 2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.]; Figs. 1[link]a and 1[link]b). The activity profile of the M405S variant is similar to that observed for the M405A variant (Oliveira et al., 2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.]) and the results confirm and reinforce that Met405 is essential for the activity and substrate affinity of DvFdhAB. Furthermore, mutation of this residue results in an increased sensitivity to oxygen.

Table 5
Kinetic parameters of WT DvFdhAB and its M405A and M405S variants

    Formate oxidation CO2 reduction  
Purification conditions Variant kcat (s−1) Km (µM) kcat/Km (s−1 mM−1) kcat (s−1) Km (µM) kcat/Km (s−1 mM−1) Reference
Aerobic WT 1310 ± 50 17 ± 3 77515 344 ± 41 324 ± 54 1090 Oliveira et al. (2020[Oliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844-3856.])
Anaerobic M405A 82 ± 2 18 ± 2 4603 43 ± 3 12253 ± 1942 4 Oliveira et al. (2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.])
Anaerobic M405S 159 ± 11 40 ± 4 3975 19 ± 2 17753 ± 4225 1 This work
[Figure 1]
Figure 1
Turnover rates of WT DvFdhAB and its M405A and M405S variants from aerobic and anaerobic purification. (a) Turnover rates for formate oxidation by WT DvFdhAB (light blue) and its M405A (orange) and M405S (purple) variants. (b) Turnover rates for CO2 reduction by WT DvFdhAB (dark blue) and its M405A (orange) and M405S (purple) variants. Data are presented as mean values ± s.d. (n = 3 technical replicates of the assay).

3.2. Structure of DvFdhAB M405S

DvFdhAB M405S yielded crystals that belonged to space group P212121 and diffracted to 2.0 Å resolution (Table 3[link]). The diffraction pattern showed anisotropy and the data were processed using STARANISO to improve the statistics and maps (Vonrhein et al., 2018[Vonrhein, C., Tickle, I. J., Flensburg, C., Keller, P., Paciorek, W., Sharff, A. & Bricogne, G. (2018). Acta Cryst. A74, a360.]). Considering an ellipsoid cutoff, the statistics showed a completeness of 93.02% and 49.47% for the overall data set and the highest resolution shell, respectively, an overall CC1/2 of 0.996 for the overall data set and 0.562 for the highest resolution shell, and a 〈I/σ(I)〉 of 1.5 for the last shell. The model was refined with good geometry indicators (0.17% Ramachandran outliers and a MolProbity score of 1.60 Å) with R-factor and Rfree values of 0.212 and 0.253, respectively (Table 4[link]). As expected, the overall structure of the M405S variant is very similar to the WT and to M405A variant structures. Superimposition of the M405S variant with oxidized WT DvFdhAB (PDB entry 6sdr) yields an r.m.s.d. of 0.37 Å for 1177 Cα atoms, superimposition with the reduced WT enzyme (PDB entry 6sdv) yields an r.m.s.d. of 0.40 Å for 1177 Cα atoms and superimposition with the M405A variant (PDB entry 8cm7) yields an r.m.s.d. of 0.28 Å for 1170 Cα atoms. However, the mutation induced structural changes in the protein backbone near the tungsten active site and its ligands (Fig. 2[link]). In the previously reported structure of the M405A variant, the structural changes in this region were unclear due to very poor electron density; the selenocysteine side chain could not be modelled and was omitted from the deposited structure (PDB entry 8cm7).

[Figure 2]
Figure 2
Effect of the M405S mutation on the structure of DvFdhAB. In all representations, the tungsten active site is shown as sticks; the tungsten ion, sulfido group and the U192 Se atom are shown as spheres (light blue, yellow and orange, respectively). (a) The M405S mutation is shown as sticks in the structure of the M405S variant (black). 2Fo − Fc electron-density maps at 1σ are shown as a blue mesh for the side chain of Ser405. The Ser405 Oγ–W distance and the hydrogen bonds established to O2α and O2β from the phosphate groups of MGD1 are shown as black and orange dashed lines, respectively. Distances are shown in Å. (b) The M405S variant (black) in a different orientation. Ser405 and the residues with greater conformational changes (U192, Thr408 and Gln409) are shown as sticks and their respective 2Fo − Fc electron-density maps at 1σ are shown as a blue mesh. (c) A superposition of the M405S (black) and M405A (PDB entry 8cm7; cyan) variants is shown. The mutated residue (Met405) and the residues with greater conformational rearrangement in the M405S variant (U192, Thr408 and Gln409) are shown as sticks. In the M405A variant the U912 side chain could not be modelled and is absent in the deposited structure. (d) A superposition of the M405S variant (black) and the oxidized WT (red; PDB entry 6sdr) is shown in the same orientation as in (c). (e) A superposition of the M405S variant (black) and the reduced WT (green; PDB entry 6sdv) is shown in the same orientation as in (c). (f) A superposition of the M405S (black) and C872A (violet; PDB entry 8cm6) variants is shown in the same orientation as in (c).

3.3. Structure comparison of DvFdhAB M405S with other variants and the wild type

In the new variant the electron density for the Ser405 side chain is well defined and its Oγ atom is stabilized by hydrogen bonds to O2α and O2β of two phosphate groups of MGD1 (Fig. 2[link]a). This interaction, which is not present in M405A, stabilizes this region and may provide an explanation for the enhanced quality of the crystals of the M405S variant and for the lack of disorder at the tungsten active site (Fig. 2[link]b).

The mutation of Met405 to serine (or alanine) led the Gln409 side chain to occupy the space left vacant by the absence of the Met405 side chain, resulting in a backbone rearrangement that pulls Thr408 4.3 Å away from its original position and causes it to interact with the protein backbone near U192 (Figs. 2c, 2[link]d and 2[link]e). Gln409 and Thr408 are superposed in M405S and C872A variants (Fig. 2f[link]).

The helix portion Ile191–Thr196, which is affected by the positioning of Thr408, was modelled in a new conformation (similar to the M405A variant; Fig. 3[link]) that was not previously seen in the WT (oxidized or reduced) or the recently reported activated C872A variant (PDB entry 8cm6), which mimics the physiological active state of the enzyme (Oliveira et al., 2024[Oliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111-119.]). This helix segment was modelled in a conformation closer to the oxidized WT form (Ile191–Ser194), moving closer to the reduced WT form and the activated C872A form from Pro195 onwards and becoming completely superposable as early as Thr196 (Fig. 3[link]). Additionally, the catalytically essential residue His193 displays a new conformation that is closer to that in the oxidized WT enzyme, but is intermediate between the oxidized and reduced states. Therefore, this new conformation, which is associated with increased backbone flexibility, is likely to interfere with the catalytic role of His193, possibly accounting for some of the loss of activity of the M405S variant. Nonetheless, using the current data we cannot determine its exact impact on the catalytic activity.

[Figure 3]
Figure 3
Effect of the absence of the Met405 side chain on the conformation of the helix region Ile191–Thr196 in DvFdhAB. In all stereo representations, the tungsten active site and the helix portion Ile191–Thr196 are shown as sticks; the tungsten ion, sulfido group and U192 Se atom are shown as spheres (light blue, yellow and orange, respectively). (a) Superposition of the M405S (black) and M405A (PDB entry 8cm7; cyan) variants. (b) Superposition of the M405S variant (black) and the oxidized WT (PDB entry 6sdr; red). (c) Superposition of the M405S variant (black) and the formate-reduced WT (green; PDB entry 6sdv). (d) Superposition of the M405S (black) and C872A (violet; PDB entry 8cm6) variants. (e) The M405S (black) variant. The 2Fo −  Fc electron-density maps at 1σ for the helix region Ile191–Thr196 and for the tungsten active site are shown as a blue mesh.

As in the M405A variant, the B factors in this region (Ile191–Thr196) of the M405S variant are very high, indicating flexibility of this helix segment arising from the absence of the large residue (Fig. 4[link]). Only loop Gly986–Ile992, which is located at the entrance to the substrate channel, has higher B factors than Ile191–Thr196 within the protein core (Fig. 4[link]a), as observed in other Fdh structures (Vilela-Alves et al., 2023[Vilela-Alves, G., Manuel, R. R., Oliveira, A. R., Cardoso Pereira, I., Romão, M. J. & Mota, C. (2023). Int. J. Mol. Sci. 24, 476.]).

[Figure 4]
Figure 4
Effect of the absence of the Met405 side chain on the B factors of the Cα atoms of Ile191–Thr196 of DvFdhAB. In all segments, the tungsten active site and the proximal [4Fe–4S] cluster are shown, in stereo representation, as sticks and spheres, the peptide chain is shown in ribbon representation and the B-factor colour scale is shown. B factors were normalized for each structure independently. (a) The M405S variant. (b) The M405A variant (PDB entry 8cm7). The loop Gly896–Ile992, which was not modelled for this data set, is represented as a grey dashed line. (c) The oxidized WT (PDB entry 6sdr). (d) The C872A variant (PDB entry 8cm6).

3.4. The tungsten-site geometry

In the structure of the M405S variant (in contrast to that of the M405A variant) the selenocysteine side chain could be modelled and the selenium location was clearly identified by the anomalous difference map (up to 4σ; Fig. 5[link]b), enabling a direct comparison of the tungsten active site (WT versus M405S variant; Fig. 5[link]a). The active site of the M405S variant is also significantly different from that in the C872A variant (equivalent to the active state of the enzyme), suggesting that the low activity displayed by the M405S variant is likely to be due to its altered active site. To better characterize the active-site geometry, the twisting and folding angles of the MGD dithiolenes were calculated as defined by Liu et al. (2022[Liu, M., Nazemi, A., Taylor, M. G., Nandy, A., Duan, C., Steeves, A. H. & Kulik, H. J. (2022). ACS Catal. 12, 383-396. ]). The twisting angle is the angle obtained from the scalar product of the two vectors connecting the two S atoms within the same dithiolene ligand and the folding angle is defined as 180° − θ, where θ is the angle formed by the two vectors connecting the metal ion and the midpoint between the S atoms from the same dithiolene ligand. The twisting angle is intended to assess the extent to which the dithiolene S atoms lie in the same plane, whereas the folding angle gauges how much the metal ion is pulled out of the plane of the four S atoms (Liu et al., 2022[Liu, M., Nazemi, A., Taylor, M. G., Nandy, A., Duan, C., Steeves, A. H. & Kulik, H. J. (2022). ACS Catal. 12, 383-396. ]). Comparison of the twisting and folding angles of the active-site coordination is presented in Fig. 6[link]. Ultimately, the substantial disparity between the tungsten active-site geometry of the M405S variant and the highly active form of the C872A variant (PBD entry 8cm6), as shown by distinct twisting and folding angles of 35.8° and 26.9° and of 64.1° and 59.0°, respectively (Fig. 6[link]), is probably correlated with the diminished reactivity of this variant. Adding to this, the metal site in the M405S variant presents higher B factors, suggesting instability (flexibility or metal depletion), which will also affect the activity.

[Figure 5]
Figure 5
Effect of the absence of the Met405 side chain on the geometry of the tungsten active site in DvFdhAB. In all segments, the tungsten active site is shown as sticks and the tungsten ion, the S atoms (sulfido ligand and MGDs dithiolene groups) and the U192 Se atom are shown as spheres (light blue, yellow and orange, respectively). (a) A superposition of the M405S variant (black), the oxidized WT (red; PDB entry 6sdr), the formate-reduced WT (green; PDB entry 6sdv) and the C872A variant (violet; PDB entry 8cm6) is shown. The structures were aligned using MGD1, as this cofactor shows the minimal conformational variability between the four structures. (b) The M405S variant (black) is shown. The anomalous map peaks at 3σ are shown as a green mesh for the W and Se atoms.
[Figure 6]
Figure 6
Active-site twisting (θt) and folding (θf) angles of the pterin planes for different forms and/or variants of Fdh (structures with resolutions above 2 Å). Structures are identified by their respective PDB codes: 6sdv, formate-reduced DvFdhAB; 7z5o, dithionite-reduced DvFdhAB; 8cm6, DvFdhAB C872A_anox; 1kqf, E. coli FdhN; 1h0h, Desulfovibrio gigas FdhAB; 5t5i, Methanobacterium wolfeii FMFD.

4. Conclusion

The crystal structure of the M405S variant of DvFdhAB allowed us to unequivocally model the complete catalytic site of an inactive form of the enzyme. The replacement of a large hydrophobic side chain by a polar and short residue, stabilized by hydrogen bonds, allowed the tungsten coordination sphere to be retained, resulting in well defined electron density to model the tungsten ligand, U192, with a clear position for the Se atom. Met405 was previously assigned to play a key structural role, but only in the present M405S variant could we confirm the significant rearrangement of the Ile191–Thr196 helical region (particularly the mechanistically relevant residues U192 and His193) and the consequent distortion of the metal coordination geometry. These observed structural changes complemented by the reported loss of activity confirm previously published results. To elucidate the putative catalytic role of Met405, further mutagenesis experiments are being planned.

Acknowledgements

We acknowledge the European Synchrotron Radiation Facility for the provision of synchrotron-radiation facilities and we would like to thank the staff of the ESRF and EMBL Grenoble for assistance and support in using beamline ID30B.

Funding information

This work is financed by national funds from Fundação para a Ciência e a Tecnologia, I.P. (FCT) through fellowship 2023.00286.BD (to V-AG), project PTDC/BII-BBF/2050/2020, the Research Unit on Applied Molecular Biosciences (UCIBIO; UIDP/04378/2020 and UIDB/04378/2020) and MOSTMICRO-ITQB (UIDB/04612/2020 and UIDP/04612/2020) and Associate Laboratories Institute for Health and Bioeconomy i4HB (LA/P/0140/2020) and LS4FUTURE (LA/P/0087/2020).

References

First citationAgirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449–461.  Web of Science CrossRef IUCr Journals Google Scholar
First citationAppel, A. M., Bercaw, J. E., Bocarsly, A. B., Dobbek, H., DuBois, D. L., Dupuis, M., Ferry, J. G., Fujita, E., Hille, R., Kenis, P. J. A., Kerfeld, C. A., Morris, R. H., Peden, C. H. F., Portis, A. R., Ragsdale, S. W., Rauchfuss, T. B., Reek, J. N. H., Seefeldt, L. C., Thauer, R. K. & Waldrop, G. L. (2013). Chem. Rev. 113, 6621–6658.  Web of Science CrossRef CAS PubMed Google Scholar
First citationAresta, M., Dibenedetto, A. & Angelini, A. (2013). J. CO2 Util. 3–4, 65–73.  Web of Science CrossRef CAS Google Scholar
First citationBoyington, J. C., Gladyshev, V. N., Khangulov, S. V., Stadtman, T. C. & Sun, P. D. (1997). Science, 275, 1305–1308.  CrossRef CAS PubMed Web of Science Google Scholar
First citationCalzadiaz-Ramirez, L. & Meyer, A. S. (2022). Curr. Opin. Biotechnol. 73, 95–100.  Web of Science CAS PubMed Google Scholar
First citationEmsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationGrimaldi, S., Schoepp-Cothenet, B., Ceccaldi, P., Guigliarelli, B. & Magalon, A. (2013). Biochim. Biophys. Acta, 1827, 1048–1085.  Web of Science CrossRef CAS PubMed Google Scholar
First citationHille, R., Hall, J. & Basu, P. (2014). Chem. Rev. 114, 3963–4038.  Web of Science CrossRef CAS PubMed Google Scholar
First citationJoosten, R. P., Salzemann, J., Bloch, V., Stockinger, H., Berglund, A.-C., Blanchet, C., Bongcam-Rudloff, E., Combet, C., Da Costa, A. L., Deleage, G., Diarena, M., Fabbretti, R., Fettahi, G., Flegel, V., Gisel, A., Kasam, V., Kervinen, T., Korpelainen, E., Mattila, K., Pagni, M., Reichstadt, M., Breton, V., Tickle, I. J. & Vriend, G. (2009). J. Appl. Cryst. 42, 376–384.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationJormakka, M., Törnroth, S., Byrne, B. & Iwata, S. (2002). Science, 295, 1863–1868.  Web of Science CrossRef PubMed Google Scholar
First citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationKanega, R., Ertem, M. Z., Onishi, N., Szalda, D. J., Fujita, E. & Himeda, Y. (2020). Organometallics, 39, 1519–1531.  Web of Science CSD CrossRef CAS Google Scholar
First citationLiu, M., Nazemi, A., Taylor, M. G., Nandy, A., Duan, C., Steeves, A. H. & Kulik, H. J. (2022). ACS Catal. 12, 383–396.   Web of Science CrossRef Google Scholar
First citationLodh, J. & Roy, S. (2022). J. Inorg. Biochem. 234, 111903.  Web of Science CrossRef PubMed Google Scholar
First citationMaia, L. B., Moura, J. J. G. & Moura, I. (2015). J. Biol. Inorg. Chem. 20, 287–309.  Web of Science CrossRef CAS PubMed Google Scholar
First citationMcCarthy, A. A., Barrett, R., Beteva, A., Caserotto, H., Dobias, F., Felisaz, F., Giraud, T., Guijarro, M., Janocha, R., Khadrouche, A., Lentini, M., Leonard, G. A., Lopez Marrero, M., Malbet-Monaco, S., McSweeney, S., Nurizzo, D., Papp, G., Rossi, C., Sinoir, J., Sorez, C., Surr, J., Svensson, O., Zander, U., Cipriani, F., Theveneau, P. & Mueller-Dieckmann, C. (2018). J. Synchrotron Rad. 25, 1249–1260.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMcCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationMurshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367.  Web of Science CrossRef CAS IUCr Journals Google Scholar
First citationNielsen, C. F., Lange, L. & Meyer, A. S. (2019). Biotechnol. Adv. 37, 107408.  Web of Science CrossRef PubMed Google Scholar
First citationNiks, D. & Hille, R. (2019). Protein Sci. 28, 111–122.  Web of Science CrossRef CAS PubMed Google Scholar
First citationOliveira, A. R., Mota, C., Klymanska, K., Biaso, F., Romao, M. J., Guigliarelli, B. & Pereira, I. C. (2022). ACS Chem. Biol. 17, 1901–1909.  Web of Science CrossRef CAS PubMed Google Scholar
First citationOliveira, A. R., Mota, C., Mourato, C., Domingos, R. M., Santos, M. F. A., Gesto, D., Guigliarelli, B., Santos-Silva, T., Romão, M. J. & Cardoso Pereira, I. A. (2020). ACS Catal. 10, 3844–3856.  Web of Science CrossRef CAS Google Scholar
First citationOliveira, A. R., Mota, C., Vilela-Alves, G., Manuel, R. R., Pedrosa, N., Fourmond, V., Klymanska, K., Léger, C., Guigliarelli, B., Romão, M. J. & Cardoso Pereira, I. A. (2024). Nat. Chem. Biol. 20, 111–119.  Web of Science CrossRef CAS PubMed Google Scholar
First citationRaaijmakers, H., Macieira, S., Dias, J. M., Teixeira, S., Bursakov, S., Huber, R., Moura, J. J. G., Moura, I. & Romão, M. J. (2002). Structure, 10, 1261–1272.  Web of Science CrossRef PubMed CAS Google Scholar
First citationRaaijmakers, H. C. A. & Romão, M. J. (2006). J. Biol. Inorg. Chem. 11, 849–854.  Web of Science CrossRef PubMed CAS Google Scholar
First citationRadon, C., Mittelstädt, G., Duffus, B. R., Bürger, J., Hartmann, T., Mielke, T., Teutloff, C., Leimkühler, S. & Wendler, P. (2020). Nat. Commun. 11, 1912.  Web of Science CrossRef PubMed Google Scholar
First citationRomão, M. J. (2009). Dalton Trans., pp. 4053–4068.  Google Scholar
First citationSchrapers, P., Hartmann, T., Kositzki, R., Dau, H., Reschke, S., Schulzke, C., Leimkühler, S. & Haumann, M. (2015). Inorg. Chem. 54, 3260–3271.  Web of Science CrossRef CAS PubMed Google Scholar
First citationSiegbahn, P. E. M. (2022). J. Phys. Chem. B, 126, 1728–1733.  Web of Science CrossRef CAS PubMed Google Scholar
First citationSilva, S. M. da, Voordouw, J., Leitão, C., Martins, M., Voordouw, G. & Pereira, I. A. C. (2013). Microbiology, 159, 1760–1769.   Web of Science PubMed Google Scholar
First citationSzczesny, J., Ruff, A., Oliveira, A. R., Pita, M., Pereira, I. A. C., De Lacey, A. L. & Schuhmann, W. (2020). ACS Energy Lett. 5, 321–327.  Web of Science CrossRef CAS Google Scholar
First citationVilela-Alves, G., Manuel, R. R., Oliveira, A. R., Cardoso Pereira, I., Romão, M. J. & Mota, C. (2023). Int. J. Mol. Sci. 24, 476.  Google Scholar
First citationVonrhein, C., Tickle, I. J., Flensburg, C., Keller, P., Paciorek, W., Sharff, A. & Bricogne, G. (2018). Acta Cryst. A74, a360.  Web of Science CrossRef IUCr Journals Google Scholar
First citationYoung, T., Niks, D., Hakopian, S., Tam, T. K., Yu, X., Hille, R. & Blaha, G. M. (2020). J. Biol. Chem. 295, 6570–6585.  Web of Science CrossRef CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds