research communications\(\def\hfill{\hskip 5em}\def\hfil{\hskip 3em}\def\eqno#1{\hfil {#1}}\)

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X

Structure of Plasmodium vivax N-myristoyltransferase with inhibitor IMP-1088: exploring an NMT inhibitor for antimalarial therapy

crossmark logo

aChemistry and Biochemistry Department, Hampton University, 200 William R. Harvey Way, Hampton, VA 23668, USA, bStructural Biology Research Unit, Faculty of Biochemistry and Molecular Medicine, University of Oulu, Aapistie 7C, 90220 Oulu, Finland, cCenter for Global Infectious Disease Research, Seattle Children's Research Institute, 307 Westlake Avenue North, Suite 500, Seattle, WA 98109, USA, dSeattle Structural Genomics Center for Infectious Diseases, Seattle, Washington, USA, eUCB BioSciences, Bainbridge Island, WA 98110, USA, fImperial College London, South Kensington Campus, London SW7 2AZ, United Kingdom, gMyricx Pharma, 125 Wood Street, London EC2V 7AN, United Kingdom, and hDartmouth Cancer Center, One Medical Center Drive, Lebanon, NH 03756, USA
*Correspondence e-mail: [email protected], [email protected]

Edited by J. Agirre, University of York, United Kingdom (Received 20 June 2024; accepted 21 November 2024)

This article is part of a focused issue on empowering education through structural genomics.

Plasmodium vivax, a significant contributor to global malaria cases, poses an escalating health burden on a substantial portion of the world's population. The increasing spread of P. vivax because of climate change underscores the development of new and rational drug-discovery approaches. The Seattle Structural Genomics Center for Infectious Diseases is taking a structure-based approach by investigating essential enzymes such as N-myristoyltransferase (NMT). P. vivax N-myristoyltransferase (PvNMT) is a promising target for the development of novel malaria treatments unlike current drugs, which target only the erythrocytic stages of the parasite. Here, the 1.8 Å resolution ternary structure of PvNMT in complex with myristoyl-CoA and IMP-1088, a validated NMT inhibitor, is reported. IMP-1088 is a validated nonpeptidic inhibitor and a ternary complex structure with human NMT has previously been reported. IMP-1088 binds similarly to PvNMT as to human NMT.

1. Introduction

Plasmodium vivax is responsible for the most widespread form of malaria and approximately 2.5 billion people, or over one-third of the world's population, are at risk of P. vivax infection (Battle et al., 2019View full citation). In humans, P. vivax can enter a dormant liver phase, which allows it to survive in various climates, including tropical and temperate regions, and contributes to its extensive geographical prevalence (Battle et al., 2019View full citation). P. vivax infection significantly impacts the quality of life of infected individuals, causing cyclical episodes of fever and weakness, representing a substantial burden in endemic countries due to treatment costs and productivity loss. P. vivax can persist in human hosts as hypnozoites in the liver that can cause relapses that can extend over several months or years (Flannery et al., 2022View full citation). Curing vivax malaria requires antimalarial drugs that are effective against both the blood and liver stages. Unfortunately, the sole licensed antimalarial with P. vivax activity, primaquine, has the drawback of inducing severe hemolysis in those with glucose-6-phosphate dehydrogenase (G6PD) deficiency, representing approximately 15% of the population in P. vivax endemic regions (Douglas et al., 2023View full citation).

The Seattle Structural Genomics Center for Infectious Diseases and collaborators are investigating rational malaria therapeutics discovery targeting essential proteins (Vijayan et al., 2021View full citation).

These efforts identified P. vivax N-myristoyltransferase (PvNMT) inhibitors that overcome drug resistance (Schlott et al., 2019View full citation). PvNMT is an essential enzyme that catalyzes a post-translational modification (myristoylation) through transfer of the lipid myristate from myristoyl coenzyme A (Myr-CoA) to the N-terminal glycine residues of proteins (Selvakumar et al., 2011View full citation; Udenwobele et al., 2017View full citation; McIlhinney, 1989View full citation). PvNMT catalyzes the myristoylation of substrate proteins that modulate crucial parasite cellular processes such as membrane association, protein–protein interactions, stability, turnover and signal transduction (Schlott et al., 2021View full citation; Selvakumar et al., 2011View full citation). Examples of plasmodial proteins that are myristoylated by NMT include glideosome-associated protein 45 (GAP45), which cannot perform its erythrocyte-invasion roles unless it is myristoylated (Schlott et al., 2021View full citation). Myristoylation of erythrocyte-binding antigen 175 (EBA-175) is required for P. vivax to invade erythrocytes (Bouyssou et al., 2023View full citation). Plasmodial exported protein 1 (EXP-1) and early transcribed membrane protein 11.2 (ETMP-11.2) must be myristoylated for parasites to exit the red blood cell (Cheng et al., 2015View full citation). Consequently, PvNMT inhibition significantly affects parasite development and survival (Garcia et al., 2022View full citation; Nicolau et al., 2023View full citation; Rodríguez-Hernández et al., 2023View full citation). Plasmodial adenylate kinases 2 are liver-stage proteins that must be myristoylated (Rodríguez-Hernández et al., 2023View full citation).

NMTs have been validated as targets for multiple parasitic diseases, including trypanosomiasis and leishmaniases (Corpas-Lopez et al., 2019View full citation; Wright et al., 2014View full citation; Frearson et al., 2010View full citation; Rodríguez-Hernández et al., 2023View full citation; Harupa et al., 2020View full citation). NMTs are promising drug targets for malaria and other diseases (Priyamvada et al., 2022View full citation; Garcia et al., 2022View full citation; Goncalves et al., 2017View full citation; Javid et al., 2023View full citation; Rackham et al., 2014View full citation; Rodríguez-Hernández et al., 2023View full citation; Bolling et al., 2024View full citation; Bell et al., 2012View full citation, 2020View full citation, 2022View full citation). The first reported family of NMT inhibitors was developed through rational design strategies utilizing peptide-mimicking substrates or nonhydrolyzable Myr-CoA analogs. Subsequently, novel families of NMT inhibitors have been identified through high-throughput screening (HTS) efforts (Goncalves et al., 2017View full citation).

IMP-1088 is an effective antipicornaviral agent with selectivity and pharmacological activity against NMT (Mousnier et al., 2018View full citation; Wright et al., 2014View full citation). IMP-1088 also effectively inhibits the production of infectious rhinovirus virions by blocking the N-myristoylation of rhinovirus VP0 (Mousnier et al., 2018View full citation). Other IMP-1088 chemotypes have been developed against NMT to treat multiple diseases, with recent efforts focusing on the development of novel PvNMT inhibitors as antimalarials (Bell et al., 2012View full citation; Rodríguez-Hernández et al., 2023View full citation; Schlott et al., 2018View full citation). Here, we present the structure of IMP-1088 in complex with PvNMT. Comparing the reported structure with that of human NMT in complex with IMP-1088 (PDB entry 5mu6; Mousnier et al., 2018View full citation) offers insights into repurposing this family of compounds as antimalarials.

2. Materials and methods

2.1. Macromolecule production

A codon-optimized gene (PvNMT; UniProt A0A1G4H3M1), encoding amino acids 27–410, was synthesized by GenScript with a 3C protease-cleavable hexahistidine tag (MGSSHHHHHHSAALEVLFQGP-ORF). Plasmid DNA was transformed into chemically competent Escherichia coli BL21(DE3) cells (Table 1[link]). The plasmid containing His-PvNMT was tested for expression, and 2 l of culture was grown using auto-induction medium (Studier, 2005View full citation) in a LEX Bio­reactor (Epiphyte Three) as described previously (Serbzhinskiy et al., 2015View full citation). The expression clone can be requested online at https://www.ssgcid.org/available-materials/expression-clones/.

Table 1
Macromolecule-production information

Source organism Plasmodium vivax Salvador I
DNA source Synthetic, GenScript
Cloning vector pET-11a
Expression vector PCR-amplified plasmid DNA
Expression host Escherichia coli BL21(DE3)R3 Rosetta
Complete amino-acid sequence of the construct produced MGSSHHHHHHSAALEVLFQGPDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL

PvNMT was purified in two steps: an immobilized metal (Ni2+) affinity chromatography (IMAC) step and size-exclusion chromatography (SEC) on an AKTApurifier 10 (GE Healthcare, now Cytiva) using automated IMAC and SEC programs (Serbzhinskiy et al., 2015View full citation). Briefly, thawed bacterial pellets (25 g) were lysed by sonication in 200 ml lysis buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 0.5%(w/v) CHAPS, 30 mM imidazole, 10 mM MgCl2, 1 mM TCEP and five tablets of protease-inhibitor cocktail (cOmplete Mini, EDTA-free Roche, Basel, Switzerland)]. After sonication, the crude lysate was treated with 20 µl (25 U ml−1) of Benzonase by incubating and mixing at room temperature for 45 min. The lysate was clarified by centrifugation at 5000g for 1 h at 277 K using a refrigerated Sorvall centrifuge (Thermo Scientific). The clarified supernatant was then passed over a 5 ml Ni–NTA HisTrap FF column (GE Healthcare, now Cytiva) which had been pre-equilibrated with loading buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 30 mM imidazole, 1 mM TCEP, 0.025%(w/v) sodium azide]. The column was washed with 20 column volumes (CV) of loading buffer and eluted with elution buffer [25 mM HEPES pH 7.0, 500 mM NaCl, 5%(v/v) glycerol, 30 mM imidazole, 1 mM TCEP, 0.025%(w/v) sodium azide, 250 mM imidazole] over a 7 CV linear gradient. Peak fractions were pooled, concentrated to 5 ml and loaded onto a Superdex 75 26/60 column (GE Biosciences) equilibrated with running buffer (20 mM HEPES pH 7.0, 300 mM NaCl, 5% glycerol, 1 mM TCEP). PvNMT eluted from the SEC column as a single, monodisperse symmetrical peak accounting for >90% of the protein product at a molecular mass of ∼40 kDa, suggesting purification as a monomer (based on a theoretical molecular weight of 47.1 kDa). The pure peak fractions were pooled and concentrated to 13.5 mg ml−1 using an Amicon purification system (Millipore). The purified protein was stored in 100 µl aliquots at 193 K and can be requested online at https://www.ssgcid.org/available-materials/ssgcid-proteins/.

2.2. Crystallization

PvNMT was crystallized using sitting-drop vapor diffusion as described in Table 2[link]. Crystals were harvested and cryoprotected with 20% ethylene glycol before data collection.

Table 2
Crystallization

Method Vapor diffusion, sitting drop
Plate type Tray 101-d6, 96-well plates
Temperature (K) 290
Protein concentration (mg ml−1) 14.88
Buffer composition of protein solution 20 mM HEPES pH 7.0, 300 mM NaCl, 5%(v/v) glycerol, 1 mM TCEP, 0.5 mM IMP-1088, 0.5 mM Myr-CoA
Composition of reservoir solution 27% PEG 3350, 200 mM ammonium sulfate, 100 mM bis-Tris pH 6.0
Volume and ratio of drop 0.4 µl, 1:1
Volume of reservoir (µl) 80

2.3. Data collection and processing

Data were collected at 100 K as detailed in Table 3[link]. Data were integrated using XDS (Kabsch, 2010View full citation) and reduced with XSCALE (Kabsch, 2010View full citation).

Table 3
Data collection and processing

Values in parentheses are for the outer shell.

Diffraction source Beamline 08ID-1, Canadian Light Source
Wavelength (Å) 0.97949
Temperature (K) 100
Detector Rayonix MX-300 CCD
Space group P212121
a, b, c (Å) 57.32, 119.13, 176.61
α, β, γ (°) 90, 90, 90
Resolution range (Å) 50–1.80 (1.85–1.80)
No. of unique reflections 112736
Completeness (%) 99.9 (99.4)
Multiplicity 7.2 (6.2)
〈I/σ(I)〉 15.21 (2.98)
Rr.i.m. 0.115 (0.562)
Overall B factor from Wilson plot (Å2) 12.320

2.4. Structure solution and refinement

The structure was determined by molecular replacement with MOLREP from the CCP4 suite of programs (Collaborative Computational Project, Number 4, 1994View full citation; Krissinel et al., 2004View full citation; Winn et al., 2011View full citation; Agirre et al., 2023View full citation) using PDB entry 4b14 (with inhibitors and waters removed) as the search model (Yu et al., 2012View full citation). The structure was refined using Phenix (Liebschner et al., 2019View full citation). The refined structure quality was assessed using MolProbity (Williams et al., 2018View full citation). Refinement statistics are listed in Table 4[link]. The coordinates and structure factors have been deposited with the Worldwide Protein Data Bank (wwPDB) as PDB entry 5v0w. Omit electron-density maps reveal ordered electron density for all of the ligands (Supplementary Fig. S1). The ligands and waters were also checked with the CheckMyBlob server (Kowiel et al., 2019View full citation; https://checkmyblob.bioreproducibility.org/server/).

Table 4
Structure solution and refinement

Values in parentheses are for the outer shell.

Resolution range (Å) 50.0–1.80 (1.84–1.80)
Completeness (%) 99.9
σ Cutoff F > 1.35σ(F)
No. of reflections, working set 112717 (7250)
No. of reflections, test set 2031 (119)
Final Rcryst 0.147 (0.227)
Final Rfree 0.184 (0.292)
No. of non-H atoms
 Protein 9405
 Ion 60
 Ligand 288
 Solvent 1697
 Total 11450
R.m.s. deviations
 Bond lengths (Å) 0.007
 Angles (°) 0.935
Average B factors (Å2)
 Protein 14.5
 Ion 53.4
 Ligand (IMP-1088) 15.5
 Ligand (myristoyl-CoA) 17.5
 Water 27.8
Ramachandran plot  
 Most favored (%) 97
 Allowed (%) 3

3. Results and discussion

The ternary structure of HsNMT1 bound to Myr-CoA and IMP-1088 was previously reported as PDB entry 5mu6 (Mousnier et al., 2018View full citation). Our reported ternary complex of PvNMT, Myr-CoA and IMP-1088 allows structure–function comparison of host and parasite inhibition by the same non­peptidic inhibitor. The ternary complex of PvNMT, Myr-CoA and the nonpeptidic inhibitor IMP-1088 was determined at a resolution of 1.8 Å (Table 3[link]). The asymmetric unit contains three monomers (Fig. 1[link]a). The three almost identical monomers adopt the prototypical NMT topology (Dian et al., 2020View full citation), with a compact, spherical configuration comprising 15 α-helices and 19 β-sheets (Figs. 1[link]a and 1[link]b). Two monomers (chains A and B) have 385 amino-acid residues (residues 26–10) and the third (chain C) has 377 residues.

[Figure 1]
Figure 1
Ternary structure of PvNMT with Myr-CoA and the inhibitor IMP-1088. (a) There are three PvNMT monomers in the asymmetric unit: A (marine), B (gray) and C (light brown). Each has a bound Myr-CoA (magenta) and IMP-1088 inhibitor (green). (b) Superposed monomers are almost identical, with an r.m.s.d. of ∼0.10 Å on Cα atoms. Each monomer is colored in a rainbow from blue at the N-terminus to red at the C-terminus. Myr-CoA is shown as magenta sticks, while the inhibitor IMP-1088 is shown as green sticks. (c) Superposed monomers of PvNMT (PDB entry 5v0w, gray), HsNMT1 (PDB entry 5mu6, pink) and HsNMT2 (PDB entry 4c2x, cyan). Myr-CoA is shown as magenta sticks, while the inhibitor IMP-1088 is shown as green sticks. (d) Solvent-accessible surface area of PvNMT colored by sequence conservation, with red indicating identical residues. The peptide/substrate-binding and myristoyl-binding cavities are shown in black parentheses.

Each monomer has two N-terminal binding cavities: the peptide/substrate-binding cavity containing the inhibitor IMP-1088 and the myristoyl-binding cavity containing Myr-CoA (Fig. 1[link]b). Consistent with other PvNMT structures, a central core with an internal pseudo-twofold symmetry axis formed by the N-terminal and C-terminal halves shapes the structure of the peptide-binding site (Goncalves et al., 2017View full citation; Rodríguez-Hernández et al., 2023View full citation; Rudnick et al., 1993View full citation; Spassov et al., 2023View full citation; Bolling et al., 2024View full citation). All loops that are near or interacting with both binding cavities are ordered in all three monomers, notably the ab loop, which forms a lid that embraces the inhibitor within the peptide/substrate-binding cavity (Fig. 1[link]d).

The top 82 closest structural neighbors of the reported structure were identified by PDBeFold (https://www.ebi.ac.uk/msd-srv/ssm/) analysis (Krissinel & Henrick, 2004View full citation) using a default threshold of 70% to be PvNMT structures with various ligands. The next 63 are human NMT structures, followed by NMTs from other organisms (Supplementary Table S1). ENDScript analyses (Gouet et al., 2003View full citation; Robert & Gouet, 2014View full citation) validate the PDBeFold results and reveal well conserved amino acids across the different NMTs (Supplementary Fig. S2). Structural and primary-sequence alignment reveals significant secondary-structure similarity between human and plasmodial NMTs (Fig. 2[link]). Superposed ribbons also show the similarity in tertiary structure of human and plasmodial NMTs (Fig. 1[link]c). A surface diagram of PvNMT reveals that the regions with the highest similarity are near the interconnected Myr-CoA-binding and peptide-binding cavities, as shown in red in Fig. 1[link](d). Notably, the myristoyl-binding cavity is well conserved across NMTs (Fig. 1[link]d). Myr-CoA binding is stabilized by a few positive charges in the mainly hydrophobic myristoyl-binding cavity (Harupa et al., 2020View full citation; Rodríguez-Hernández et al., 2023View full citation; Bolling et al., 2024View full citation). LigPlus analysis (Laskowski & Swindells, 2011View full citation; Wallace et al., 1995View full citation) shows that the amino acids interacting with Myr-CoA are almost identical in PvNMT (PDB entry 5v0w) compared with HsNMT1 (PDB entry 5mu6) and HsNMT2 (PDB entry 4c2x) (Fig. 3[link]).

[Figure 2]
Figure 2
(a) The alignment shows residue conservation between NMTs from different organisms. Residues within the cofactor-binding pocket are shown in purple, while those in the substrate-binding pocket are shown in green. The secondary-structure alignment is based on our reported structure. (b) The residues located in the C-termini of different NMTs. The following NMTs are included in the alignment: PvNMT, P. falciparum NMT, HsNMT1, HsNMT2, Saccharomyces cerevisiae NMT, Candida albicans NMT, Aspergillus fumigatus NMT, A. flavus NMT, Leishmania major NMT, L. donovani NMT and Cryptosporidium parvum NMT.
[Figure 3]
Figure 3
Myr-CoA binding by NMTs. Conserved amino-acid residues mediate Myr-CoA binding in (a) PvNMT (PDB entry 5v0w), (b) HsNMT1 (PDB entry 5mu6) and (c) HsNMT2 (PDB entry 4c2x). This figure and other ligand-interaction figures were generated with LigPlus (https://www.ebi.ac.uk/thornton-srv/software/LigPlus/).

IMP-1088 binds to a predominantly hydrophobic peptide/substrate-binding cavity stabilized by several hydrogen bonds and salt bridges (Fig. 4[link]a). The peptide/substrate-binding cavity is less well conserved across NMTs (Bolling et al., 2024View full citation), as indicated by the white patch in Fig. 1[link](d). The amino-acid residues interacting with IMP-1088 are almost identical in the PvNMT (PDB entry 5v0w) and HsNMT1 (PDB entry 5mu6) structures. Notably, the serine mediating a hydrogen bond involved in inhibitor binding is conserved, as are most residues involved in IMP-1088 binding (Figs. 4[link]a and 4[link]b). Nonetheless, while PvNMT interacts with IMP-1088 through a leucine residue (Leu410), HsNMT forms contacts with the compound via a glutamine residue (Gln496) (Figs. 4[link]a and 4[link]b).

[Figure 4]
Figure 4
Comparison of inhibitor binding by NMTs. PvNMT interacts with IMP-1088 (PDB entry 5v0w) (a) with similar amino acids as HsNMT1 (PDB entry 5mu6) (b). Inhibitor IMP-1002 interacts with fewer amino acids on PvNMT (PDB entry 6mb1) (c), as does inhibitor DDD85646 with PvNMT (PDB entry 5g1z) (d).

IMP-series inhibitors generally exhibit excellent efficacy against P. vivax (Mousnier et al., 2018View full citation). For example, IMP-1031, an analog of IMP-1088, had an IC50 value of approximately 200 pM in a P. berghei liver-stage assay (Bell et al., 2012View full citation, 2020View full citation, 2022View full citation). The comparison of complex structures of PvNMT and promising IMP-series inhibitors reveals similar interactions (Fig. 4[link]). IMP-1002, an analog of IMP-1088 discovered through a fragment-reconstruction approach based on hits from screens against PvNMT and P. falciparum NMT (Mousnier et al., 2018View full citation; Schlott et al., 2019View full citation), binds similarly to IMP-1088. Interestingly, IMP-1002 exhibits a fourfold higher potency in killing parasites than the most potent previously reported PvNMT inhibitor, DDD85646 (Wright et al., 2014View full citation). LigPlus analysis of the PvNMT structures reveals that DDD85646 (PDB entry 5g1z) interacts with fewer amino-acid residues than IMP-1002 (PDB entry 6mb1) and IMP-1088 (PDB entry 5v0w) (Figs. 4[link]c and 4[link]d, Table 5[link]).

Table 5
Residues involved in ligand binding

  PDB entry 5v0w PDB entry 5mu6 PDB entry 6mb1 PDB entry 5g1z
Hydrogen-bond contacts Ser319 Ser405 Ser319 Ser319
Non-hydrogen-bond contacts Val96 Val181 Val96 Val96
Asp98 Asp183 Asp98 Glu97
Phe103 Phe188 Phe103 Asp98
Arg104 Arg189 Phe105 Phe103
Phe105 Phe190 Tyr107 Phe105
Tyr107 Tyr192 Asn161 Tyr211
Asn161 Asn246 Thr197 Phe226
Thr197 Thr282 Gly199 Ser319
Gly199 Gly284 Tyr211 Leu330
Tyr211 Tyr296 Ser319 Tyr334
His213 His298 Tyr334 Asn365
Ser319 Ser405 Asn365  
Tyr334 Tyr420 Ala366  
Asn365 Asn451 Leu367  
Ala366 Ala452 Leu388  
Leu367 Leu453 Leu409  
Leu388 Leu474 Leu410  
Leu409 Leu495    
Leu410 Gln496    

The structure of the complex of HsNMT1 with an inhibitor peptide (GNCFSKPR) and Myr-CoA (PDB entry 8q26) was released in August 2024 (Rivière et al., 2024View full citation). This structure allows the entire peptide-binding cavity of HsNMT1 to be probed, revealing the amino-acid residues involved in peptide binding (Fig. 5[link]). LigPlus analysis after alignment of the peptide (GNCFSKPR) inhibitor with PvNMT reveals a similar network of amino-acid interactions within well conserved substrate/peptide-binding cavities (Fig. 5[link]). Substrate-binding specificity is ensured via the preferential binding of glycine residues by the myristoyl-binding cavity (Harupa et al., 2020View full citation).

[Figure 5]
Figure 5
Interactions in the peptide/substrate-binding cavity. (a) Interactions between HsNMT1 and a peptide inhibitor (GNCFSKPR; PDB entry 8q26). (b) The modeled superposed PvNMT structure (starting from PDB entry 5v0w with ligands removed) shows conserved interactions with the peptide inhibitor.

4. Conclusions

The ternary structure of P. vivax N-myristoyltransferase (PvNMT) with IMP-1088 and Myr-CoA is presented. Ongoing efforts to develop IMP-1088-like compounds as antimalarials include testing the inhibitory activity of IMP-1088 against PvNMT.

Biographical information

[link]

[Scheme 1]
Early career authors: Alex Mendez, Cydni Bolling and Shane Taylor.

Funding information

This project has been funded in whole or in part with Federal funds from the National Institute of Allergy and Infectious Diseases, National Institutes of Health, Department of Health and Human Services under Contract No. 75N93022C00036. AM, CB and ST are URISE scholars funded by the NIGMS (grant No. T34GM136489). This project is part of a SSGCID collaboration training Hampton University students in structural science, rational structure-based drug discovery and scientific communication funded partly by the NIGMS (grant U01GM138433 to OAA).

References

Return to citationAgirre, J., Atanasova, M., Bagdonas, H., Ballard, C. B., Baslé, A., Beilsten-Edmands, J., Borges, R. J., Brown, D. G., Burgos-Mármol, J. J., Berrisford, J. M., Bond, P. S., Caballero, I., Catapano, L., Chojnowski, G., Cook, A. G., Cowtan, K. D., Croll, T. I., Debreczeni, J. É., Devenish, N. E., Dodson, E. J., Drevon, T. R., Emsley, P., Evans, G., Evans, P. R., Fando, M., Foadi, J., Fuentes-Montero, L., Garman, E. F., Gerstel, M., Gildea, R. J., Hatti, K., Hekkelman, M. L., Heuser, P., Hoh, S. W., Hough, M. A., Jenkins, H. T., Jiménez, E., Joosten, R. P., Keegan, R. M., Keep, N., Krissinel, E. B., Kolenko, P., Kovalevskiy, O., Lamzin, V. S., Lawson, D. M., Lebedev, A. A., Leslie, A. G. W., Lohkamp, B., Long, F., Malý, M., McCoy, A. J., McNicholas, S. J., Medina, A., Millán, C., Murray, J. W., Murshudov, G. N., Nicholls, R. A., Noble, M. E. M., Oeffner, R., Pannu, N. S., Parkhurst, J. M., Pearce, N., Pereira, J., Perrakis, A., Powell, H. R., Read, R. J., Rigden, D. J., Rochira, W., Sammito, M., Sánchez Rodríguez, F., Sheldrick, G. M., Shelley, K. L., Simkovic, F., Simpkin, A. J., Skubak, P., Sobolev, E., Steiner, R. A., Stevenson, K., Tews, I., Thomas, J. M. H., Thorn, A., Valls, J. T., Uski, V., Usón, I., Vagin, A., Velankar, S., Vollmar, M., Walden, H., Waterman, D., Wilson, K. S., Winn, M. D., Winter, G., Wojdyr, M. & Yamashita, K. (2023). Acta Cryst. D79, 449–461.  Web of Science CrossRef IUCr Journals Google Scholar
Return to citationBattle, K. E., Lucas, T. C. D., Nguyen, M., Howes, R. E., Nandi, A. K., Twohig, K. A., Pfeffer, D. A., Cameron, E., Rao, P. C., Casey, D., Gibson, H. S., Rozier, J. A., Dalrymple, U., Keddie, S. H., Collins, E. L., Harris, J. R., Guerra, C. A., Thorn, M. P., Bisanzio, D., Fullman, N., Huynh, C. K., Kulikoff, X., Kutz, M. J., Lopez, A. D., Mokdad, A. H., Naghavi, M., Nguyen, G., Shackelford, K. A., Vos, T., Wang, H., Lim, S. S., Murray, C. J. L., Price, R. N., Baird, J. K., Smith, D. L., Bhatt, S., Weiss, D. J., Hay, S. I. & Gething, P. W. (2019). Lancet, 394, 332–343.  Web of Science CrossRef PubMed Google Scholar
Return to citationBell, A. S., Mills, J. E., Williams, G. P., Brannigan, J. A., Wilkinson, A. J., Parkinson, T., Leatherbarrow, R. J., Tate, E. W., Holder, A. A. & Smith, D. F. (2012). PLoS Negl. Trop. Dis. 6, e1625.  Web of Science CrossRef PubMed Google Scholar
Return to citationBell, A. S., Tate, E. W., Leatherbarrow, R. J., Hutton, J. A. & Brannigan, J. A. (2020). US Patent US11466011B2.  Google Scholar
Return to citationBell, A. S., Tate, E. W., Leatherbarrow, R. J., Hutton, J. A. & Brannigan, J. A. (2022). World Patent WO2017001812A1.  Google Scholar
Return to citationBolling, C., Mendez, A., Taylor, S., Makumire, S., Reers, A., Zigweid, R., Subramanian, S., Dranow, D. M., Staker, B., Edwards, T. E., Tate, E. W., Bell, A. S., Myler, P. J., Asojo, O. A. & Chakafana, G. (2024). Acta Cryst. F80, 269–277.  Web of Science CrossRef IUCr Journals Google Scholar
Return to citationBouyssou, I., El Hoss, S., Doderer-Lang, C., Schoenhals, M., Rasoloharimanana, L. T., Vigan-Womas, I., Ratsimbasoa, A., Abate, A., Golassa, L., Mabilotte, S., Kessler, P., Guillotte-Blisnick, M., Martinez, F. J., Chitnis, C. E., Strouboulis, J. & Ménard, D. (2023). Cell Host Microbe, 31, 2080–2092.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationCheng, Y., Lu, F., Lee, S. K., Kong, D. H., Ha, K. S., Wang, B., Sattabongkot, J., Tsuboi, T. & Han, E. T. (2015). PLoS One, 10, e0127500.  Web of Science CrossRef PubMed Google Scholar
Return to citationCollaborative Computational Project, Number 4 (1994). Acta Cryst. D50, 760–763.  CrossRef Web of Science IUCr Journals Google Scholar
Return to citationCorpas-Lopez, V., Moniz, S., Thomas, M., Wall, R. J., Torrie, L. S., Zander-Dinse, D., Tinti, M., Brand, S., Stojanovski, L., Manthri, S., Hallyburton, I., Zuccotto, F., Wyatt, P. G., De Rycker, M., Horn, D., Ferguson, M. A. J., Clos, J., Read, K. D., Fairlamb, A. H., Gilbert, I. H. & Wyllie, S. (2019). ACS Infect. Dis. 5, 111–122.  Web of Science CAS PubMed Google Scholar
Return to citationDian, C., Pérez-Dorado, I., Rivière, F., Asensio, T., Legrand, P., Ritzefeld, M., Shen, M., Cota, E., Meinnel, T., Tate, E. W. & Giglione, C. (2020). Nat. Commun. 11, 1132.  Web of Science CrossRef PubMed Google Scholar
Return to citationDouglas, N. M., Piera, K. A., Rumaseb, A., Ley, B., Anstey, N. M. & Price, R. N. (2023). Am. J. Trop. Med. Hyg. 108, 76–80.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationFlannery, E. L., Kangwanrangsan, N., Chuenchob, V., Roobsoong, W., Fishbaugher, M., Zhou, K., Billman, Z. P., Martinson, T., Olsen, T. M., Schäfer, C., Campo, B., Murphy, S. C., Mikolajczak, S. A., Kappe, S. H. I. & Sattabongkot, J. (2022). Mol. Ther. Methods Clin. Dev. 26, 427–440.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationFrearson, J. A., Brand, S., McElroy, S. P., Cleghorn, L. A., Smid, O., Stojanovski, L., Price, H. P., Guther, M. L., Torrie, L. S., Robinson, D. A., Hallyburton, I., Mpamhanga, C. P., Brannigan, J. A., Wilkinson, A. J., Hodgkinson, M., Hui, R., Qiu, W., Raimi, O. G., van Aalten, D. M., Brenk, R., Gilbert, I. H., Read, K. D., Fairlamb, A. H., Ferguson, M. A., Smith, D. F. & Wyatt, P. G. (2010). Nature, 464, 728–732.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationGarcia, M. L., de Oliveira, A. A., Bueno, R. V., Nogueira, V. H. R., de Souza, G. E. & Guido, R. V. C. (2022). Drug Dev. Res. 83, 264–284.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationGoncalves, V., Brannigan, J. A., Laporte, A., Bell, A. S., Roberts, S. M., Wilkinson, A. J., Leatherbarrow, R. J. & Tate, E. W. (2017). Med. Chem. Commun. 8, 191–197.  Web of Science CrossRef CAS Google Scholar
Return to citationGouet, P., Robert, X. & Courcelle, E. (2003). Nucleic Acids Res. 31, 3320–3323.  Web of Science CrossRef PubMed CAS Google Scholar
Return to citationHarupa, A., De Las Heras, L., Colmenarejo, G., Lyons-Abbott, S., Reers, A., Caballero Hernandez, I., Chung, C. W., Charter, D., Myler, P. J., Fernández-Menéndez, R. M., Calderón, F., Palomo, S., Rodríguez, B., Berlanga, M., Herreros-Avilés, E., Staker, B. L., Fernández Álvaro, E. & Kaushansky, A. (2020). J. Med. Chem. 63, 591–600.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationJavid, S., Ather, H., Hani, U., Siddiqua, A., Asif Ansari, S. M., Shanmugarajan, D., Yogish Kumar, H., Arivuselvam, R., Purohit, M. N. & Kumar, B. R. P. (2023). Antibiotics, 12, 1167.  Web of Science CrossRef PubMed Google Scholar
Return to citationKabsch, W. (2010). Acta Cryst. D66, 125–132.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationKowiel, M., Brzezinski, D., Porebski, P. J., Shabalin, I. G., Jaskolski, M. & Minor, W. (2019). Bioinformatics, 35, 452–461.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationKrissinel, E. & Henrick, K. (2004). Acta Cryst. D60, 2256–2268.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationKrissinel, E. B., Winn, M. D., Ballard, C. C., Ashton, A. W., Patel, P., Potterton, E. A., McNicholas, S. J., Cowtan, K. D. & Emsley, P. (2004). Acta Cryst. D60, 2250–2255.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationLaskowski, R. A. & Swindells, M. B. (2011). J. Chem. Inf. Model. 51, 2778–2786.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationLiebschner, D., Afonine, P. V., Baker, M. L., Bunkóczi, G., Chen, V. B., Croll, T. I., Hintze, B., Hung, L.-W., Jain, S., McCoy, A. J., Moriarty, N. W., Oeffner, R. D., Poon, B. K., Prisant, M. G., Read, R. J., Richardson, J. S., Richardson, D. C., Sammito, M. D., Sobolev, O. V., Stockwell, D. H., Terwilliger, T. C., Urzhumtsev, A. G., Videau, L. L., Williams, C. J. & Adams, P. D. (2019). Acta Cryst. D75, 861–877.  Web of Science CrossRef IUCr Journals Google Scholar
Return to citationMcIlhinney, R. A. (1989). Biochem. Soc. Trans. 17, 861–863.  CrossRef CAS PubMed Web of Science Google Scholar
Return to citationMousnier, A., Bell, A. S., Swieboda, D. P., Morales-Sanfrutos, J., Pérez-Dorado, I., Brannigan, J. A., Newman, J., Ritzefeld, M., Hutton, J. A., Guedán, A., Asfor, A. S., Robinson, S. W., Hopkins-Navratilova, I., Wilkinson, A. J., Johnston, S. L., Leatherbarrow, R. J., Tuthill, T. J., Solari, R. & Tate, E. W. (2018). Nat. Chem. 10, 599–606.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationNicolau, M. S. P., Resende, M. A., Serafim, P., Lima, G. Y. P., Ueira-Vieira, C., Nicolau-Junior, N. & Yoneyama, K. A. G. (2023). J. Biomol. Struct. Dyn. 41, 7019–7031.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationPriyamvada, L., Kallemeijn, W. W., Faronato, M., Wilkins, K., Goldsmith, C. S., Cotter, C. A., Ojeda, S., Solari, R., Moss, B., Tate, E. W. & Satheshkumar, P. S. (2022). PLoS Pathog. 18, e1010662.  Web of Science CrossRef PubMed Google Scholar
Return to citationRackham, M. D., Brannigan, J. A., Rangachari, K., Meister, S., Wilkinson, A. J., Holder, A. A., Leatherbarrow, R. J. & Tate, E. W. (2014). J. Med. Chem. 57, 2773–2788.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationRivière, F., Dian, C., Dutheil, R. F., Monassa, P., Giglione, C. & Meinnel, T. (2024). Structure, 32, 1737–1750.  Web of Science PubMed Google Scholar
Return to citationRobert, X. & Gouet, P. (2014). Nucleic Acids Res. 42, W320–W324.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationRodríguez-Hernández, D., Vijayan, K., Zigweid, R., Fenwick, M. K., Sankaran, B., Roobsoong, W., Sattabongkot, J., Glennon, E. K. K., Myler, P. J., Sunnerhagen, P., Staker, B. L., Kaushansky, A. & Grøtli, M. (2023). Nat. Commun. 14, 5408.  Web of Science PubMed Google Scholar
Return to citationRudnick, D. A., McWherter, C. A., Gokel, G. W. & Gordon, J. I. (1993). Adv. Enzymol. Relat. Areas Mol. Biol. 67, 375–430.  CAS PubMed Web of Science Google Scholar
Return to citationSchlott, A. C., Holder, A. A. & Tate, E. W. (2018). ACS Infect. Dis. 4, 449–457.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationSchlott, A. C., Knuepfer, E., Green, J. L., Hobson, P., Borg, A. J., Morales-Sanfrutos, J., Perrin, A. J., Maclachlan, C., Collinson, L. M., Snijders, A. P., Tate, E. W. & Holder, A. A. (2021). PLoS Biol. 19, e3001408.  Web of Science CrossRef PubMed Google Scholar
Return to citationSchlott, A. C., Mayclin, S., Reers, A. R., Coburn-Flynn, O., Bell, A. S., Green, J., Knuepfer, E., Charter, D., Bonnert, R., Campo, B., Burrows, J., Lyons-Abbott, S., Staker, B. L., Chung, C. W., Myler, P. J., Fidock, D. A., Tate, E. W. & Holder, A. A. (2019). Cell. Chem. Biol. 26, 991–1000.e7.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationSelvakumar, P., Kumar, S., Dimmock, J. R. & Sharma, R. K. (2011). Atlas Genet. Cytogenet. Oncol. Haematol. 15, 570–575.  PubMed Google Scholar
Return to citationSerbzhinskiy, D. A., Clifton, M. C., Sankaran, B., Staker, B. L., Edwards, T. E. & Myler, P. J. (2015). Acta Cryst. F71, 594–599.  Web of Science CrossRef IUCr Journals Google Scholar
Return to citationSpassov, D. S., Atanasova, M. & Doytchinova, I. (2023). Int. J. Mol. Sci. 24, 11610.  Web of Science CrossRef PubMed Google Scholar
Return to citationStudier, F. W. (2005). Protein Expr. Purif. 41, 207–234.  Web of Science CrossRef PubMed CAS Google Scholar
Return to citationUdenwobele, D. I., Su, R. C., Good, S. V., Ball, T. B., Varma Shrivastav, S. & Shrivastav, A. (2017). Front. Immunol. 8, 751.  Web of Science CrossRef PubMed Google Scholar
Return to citationVijayan, K., Wei, L., Glennon, E. K. K., Mattocks, C., Bourgeois, N., Staker, B. & Kaushansky, A. (2021). Chem. Rev. 121, 10452–10468.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationWallace, A. C., Laskowski, R. A. & Thornton, J. M. (1995). Protein Eng. Des. Sel. 8, 127–134.  CrossRef CAS Web of Science Google Scholar
Return to citationWilliams, C. J., Headd, J. J., Moriarty, N. W., Prisant, M. G., Videau, L. L., Deis, L. N., Verma, V., Keedy, D. A., Hintze, B. J., Chen, V. B., Jain, S., Lewis, S. M., Arendall, W. B., Snoeyink, J., Adams, P. D., Lovell, S. C., Richardson, J. S. & Richardson, J. S. (2018). Protein Sci. 27, 293–315.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationWinn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G. W., McCoy, A., McNicholas, S. J., Murshudov, G. N., Pannu, N. S., Potterton, E. A., Powell, H. R., Read, R. J., Vagin, A. & Wilson, K. S. (2011). Acta Cryst. D67, 235–242.  Web of Science CrossRef CAS IUCr Journals Google Scholar
Return to citationWright, M. H., Clough, B., Rackham, M. D., Rangachari, K., Brannigan, J. A., Grainger, M., Moss, D. K., Bottrill, A. R., Heal, W. P., Broncel, M., Serwa, R. A., Brady, D., Mann, D. J., Leatherbarrow, R. J., Tewari, R., Wilkinson, A. J., Holder, A. A. & Tate, E. W. (2014). Nat. Chem. 6, 112–121.  Web of Science CrossRef CAS PubMed Google Scholar
Return to citationYu, Z., Brannigan, J. A., Moss, D. K., Brzozowski, A. M., Wilkinson, A. J., Holder, A. A., Tate, E. W. & Leatherbarrow, R. J. (2012). J. Med. Chem. 55, 8879–8890.  Web of Science CrossRef CAS PubMed Google Scholar

This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.

Journal logoSTRUCTURAL BIOLOGY
COMMUNICATIONS
ISSN: 2053-230X
Follow Acta Cryst. F
Sign up for e-alerts
Follow Acta Cryst. on Twitter
Follow us on facebook
Sign up for RSS feeds